StarFunc result for job id Q12923

User Input

>input (2485 residues)
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
MGFLSIKDTQDENYFKDILSDNSGREDSENTFSPYQFKTSGPEKKPIPGIDVLSKKKIWA
SSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMD
PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPS
IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFDM
VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
KFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHGFQTDNSKICQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASWE
EKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGMTMHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVHLTNEMKNYM
KKSSYMQDSAIDSSSKDHHWSRGTLRHISENSFGPSGGLREGSLSSQDSRTESASLSQSQ
VNGFFASHLGDQTWQESQHGSPSPSVISKATEKETFTDSNQSKTKKPGISDVTDYSDRGD
SDMDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGI
SVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNAQGQGPEKVKKTTQVKDYSFVTEENTF
EVKLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVILKVNGA
SLKGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSSKDSSQ
PSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWSSALH
QTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPGQSYQP
QSESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLEDFELEVELLITLIKSEKGSLG
FTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRAASKT
VRLVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQVVYISDINPRSVAA
IEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKRSAVSA
PKSTKGNGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCSTYQIKGSPNLTLPKE
SYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGYSCGPGTLKMNGKLSEERTE
DTDCDGSPLPEYFTEATKMNGCEEYCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIER
TNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENL
QELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFVYI
ACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNRLRLA
LVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHR
SGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFC
YQVILYVLTRLQAEEEQKQQPQLLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V9S3	0.295	0.299	0.000	2455	0.785	0.795	G3V9S3.pdb.gz	G3V9S3_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=2
2	AFDB:Q12923	1.000	1.000	0.000	2485	1.000	1.000	Q12923.pdb.gz	PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2
3	AFDB:Q64512	0.345	0.348	0.000	2453	0.801	0.811	Q64512.pdb.gz	PTN13_MOUSE Tyrosine-protein phosphatase non-receptor type 13 OS=Mus musculus OX=10090 GN=Ptpn13 PE=1 SV=2
4	PDB:3ps5A	0.112	0.505	8.623E-21	529	0.045	0.214	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
5	PDB:5xzrA	0.107	0.493	6.254E-19	519	0.046	0.220	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
6	PDB:4gwfA	0.105	0.508	6.566E-19	497	0.045	0.223	4gwfA.pdb.gz
7	PDB:4rm8A	0.109	0.677	6.566E-19	368	0.037	0.247	4rm8A.pdb.gz
8	PDB:6krwA	0.107	0.804	3.118E-18	306	0.037	0.297	6krwA.pdb.gz
9	AFDB:P23471	0.105	0.112	3.530E-17	2315	0.136	0.146	P23471.pdb.gz	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
10	AFDB:Q62656	0.104	0.111	2.138E-16	2316	0.126	0.136	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
11	AFDB:Q0KHR3	0.045	0.065	4.438E-16	1520	0.084	0.138	Q0KHR3.pdb.gz	Q0KHR3_DROME Bazooka, isoform B OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
12	PDB:3m4uA	0.102	0.821	4.343E-14	285	0.030	0.260	3m4uA.pdb.gz
13	PDB:2xkxA	0.052	0.122	7.066E-14	721	0.043	0.148	2xkxA.pdb.gz
14	AFDB:E9Q9R9	0.038	0.049	7.621E-13	1921	0.054	0.070	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
15	AFDB:A0A1D5NS76	0.037	0.050	2.224E-12	2005	0.080	0.099	A0A1D5NS76.pdb.gz
16	AFDB:Q9VUH6	0.089	0.119	2.335E-12	1833	0.089	0.121	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
17	AFDB:D4A3K7	0.104	0.147	3.989E-12	1705	0.107	0.157	D4A3K7.pdb.gz	D4A3K7_RAT FERM and PDZ domain containing 4 OS=Rattus norvegicus OX=10116 GN=Frmpd4 PE=4 SV=2
18	PDB:6r9tA	0.066	0.075	1.482E-7	2185	0.016	0.018	6r9tA.pdb.gz
19	PDB:7c3mA	0.091	0.355	1.556E-7	577	0.022	0.095	7c3mA.pdb.gz
20	PDB:7pc3A	0.036	0.216	2.053E-6	405	0.014	0.086	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1K1	0.0	3796	2445	0.784	0.797	A0A0G2K1K1_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=1
2	A0A8I5ZZK7	0.0	3169	2273	0.658	0.720	A0A8I5ZZK7_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=3 SV=1
3	A0A8I6A6L8	0.0	1551	2266	0.344	0.377	A0A8I6A6L8_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=3 SV=1
4	G3V9S3	0.0	3821	2460	0.788	0.796	G3V9S3_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=2
5	Q12923	0.0	5147	2485	1.000	1.000	PTN13_HUMAN Tyrosine-protein phosphatase non-receptor type 13 OS=Homo sapiens OX=9606 GN=PTPN13 PE=1 SV=2
6	Q64512	0.0	3931	2453	0.802	0.812	PTN13_MOUSE Tyrosine-protein phosphatase non-receptor type 13 OS=Mus musculus OX=10090 GN=Ptpn13 PE=1 SV=2
7	Q6EHH9	0.0	2625	2500	0.586	0.582	Q6EHH9_XENLA Frizzled-8 associated multidomain protein (Fragment) OS=Xenopus laevis OX=8355 GN=FRIED PE=1 SV=1
8	Q68DX3	2.09e-86	314	1309	0.064	0.121	FRPD2_HUMAN FERM and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FRMPD2 PE=1 SV=3
9	Q4JDL3	2.58e-73	254	420	0.047	0.279	PTN20_HUMAN Tyrosine-protein phosphatase non-receptor type 20 OS=Homo sapiens OX=9606 GN=PTPN20 PE=1 SV=1
10	Q562B7	1.09e-54	196	306	0.043	0.353	Q562B7_RAT Ptpn3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=2 SV=1
11	Q9HD43	1.49e-52	206	1115	0.043	0.096	PTPRH_HUMAN Receptor-type tyrosine-protein phosphatase H OS=Homo sapiens OX=9606 GN=PTPRH PE=1 SV=4
12	A0A096MJA1	4.34e-51	200	967	0.043	0.112	A0A096MJA1_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=1 SV=2
13	P29351	4.57e-51	194	595	0.046	0.192	PTN6_MOUSE Tyrosine-protein phosphatase non-receptor type 6 OS=Mus musculus OX=10090 GN=Ptpn6 PE=1 SV=2
14	A0A8I5ZUL2	5.21e-51	199	935	0.043	0.116	A0A8I5ZUL2_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=1 SV=1
15	F1LQQ5	5.50e-51	200	1018	0.043	0.106	F1LQQ5_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=3 SV=2
16	A0A8I5YBL2	6.88e-51	199	932	0.043	0.116	A0A8I5YBL2_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=1 SV=1
17	A0A2R8Q2T0	8.00e-51	193	590	0.042	0.178	A0A2R8Q2T0_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=Hcph PE=3 SV=1
18	P26045	8.12e-51	199	913	0.044	0.120	PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens OX=9606 GN=PTPN3 PE=1 SV=2
19	E7F3D4	8.54e-51	193	589	0.042	0.178	E7F3D4_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=Hcph PE=2 SV=2
20	Q803M6	9.82e-51	193	589	0.042	0.178	Q803M6_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=fj22f05 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	7.5	17.8	Dual specificity phosphatase, catalytic domain
2	PF19805 DUF6288	1.6	19.4	Family of unknown function (DUF6288)
3	PF09380 FERM_C	1.8e-17	74.8	FERM C-terminal PH-like domain
4	PF00373 FERM_M	2.8e-21	87.4	FERM central domain
5	PF09379 FERM_N	6.5e-14	62.9	FERM N-terminal domain
6	PF16474 KIND	0.011	27.2	Kinase non-catalytic C-lobe domain
7	PF00595 PDZ	7e-73	252.3	PDZ domain
8	PF13180 PDZ_2	1.8e-18	78.0	PDZ domain
9	PF17820 PDZ_6	2.1e-35	131.7	PDZ domain
10	PF02163 Peptidase_M50	1.2e-06	39.6	Peptidase family M50
11	PF16599 PTN13_u3	2e-72	254.9	Unstructured linker region on PTN13 protein between PDZ
12	PF14566 PTPlike_phytase	1.7e+02	13.7	Inositol hexakisphosphate
13	PF00102 Y_phosphatase	1.1e-69	246.2	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347979	0.995	Tumor necrosis factor receptor superfamily member 6
2	9606.ENSP00000204961	0.982	Ephrin-B1
3	9606.ENSP00000296859	0.981	Rap guanine nucleotide exchange factor 6
4	9606.ENSP00000356694	0.968	Tumor necrosis factor ligand superfamily member 6
5	9606.ENSP00000357986	0.964	Pleckstrin homology domain-containing family A member 1
6	9606.ENSP00000355923	0.959	Tyrosine-protein phosphatase non-receptor type 14
7	9606.ENSP00000257430	0.954	Adenomatous polyposis coli protein
8	9606.ENSP00000362680	0.950	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000301838	0.947	FAS-associated death domain protein
10	9606.ENSP00000311857	0.944	Tyrosine-protein phosphatase non-receptor type 2
11	9606.ENSP00000381097	0.944	Ephrin type-B receptor 1
12	9606.ENSP00000263708	0.937	Tyrosine-protein phosphatase non-receptor type 4
13	9606.ENSP00000351273	0.936	Caspase-8
14	9606.ENSP00000363763	0.933	Ephrin type-B receptor 2
15	9606.ENSP00000340944	0.929	Tyrosine-protein phosphatase non-receptor type 11
16	9606.ENSP00000248594	0.927	Tyrosine-protein phosphatase non-receptor type 12
17	9606.ENSP00000265562	0.926	Tyrosine-protein phosphatase non-receptor type 23
18	9606.ENSP00000329797	0.926	Cell adhesion molecule 1
19	9606.ENSP00000391592	0.926	Tyrosine-protein phosphatase non-receptor type 6
20	9606.ENSP00000309116	0.925	Tyrosine-protein phosphatase non-receptor type 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0004721	0.991	phosphoprotein phosphatase activity
GO:0004725	0.984	protein tyrosine phosphatase activity
GO:0043548	0.767	phosphatidylinositol 3-kinase binding
GO:0036312	0.577	phosphatidylinositol 3-kinase regulatory subunit binding
GO:0019899	0.376	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0048523	0.984	negative regulation of cellular process
GO:0050896	0.978	response to stimulus
GO:0001933	0.957	negative regulation of protein phosphorylation
GO:0051716	0.949	cellular response to stimulus
GO:0051239	0.947	regulation of multicellular organismal process
GO:0051128	0.946	regulation of cellular component organization
GO:0044087	0.946	regulation of cellular component biogenesis
GO:1901888	0.944	regulation of cell junction assembly
GO:0071704	0.926	organic substance metabolic process
GO:0070887	0.924	cellular response to chemical stimulus
GO:0044238	0.921	primary metabolic process
GO:0006807	0.903	nitrogen compound metabolic process
GO:0044237	0.903	cellular metabolic process
GO:0043170	0.881	macromolecule metabolic process
GO:0050793	0.867	regulation of developmental process
GO:0051241	0.863	negative regulation of multicellular organismal process
GO:1901564	0.845	organonitrogen compound metabolic process
GO:0016311	0.841	dephosphorylation
GO:0051129	0.832	negative regulation of cellular component organization
GO:0048583	0.822	regulation of response to stimulus
GO:0051093	0.808	negative regulation of developmental process
GO:0006470	0.772	protein dephosphorylation
GO:0097237	0.766	cellular response to toxic substance
GO:0010646	0.754	regulation of cell communication
GO:0023051	0.723	regulation of signaling
GO:0009966	0.694	regulation of signal transduction
GO:1902531	0.605	regulation of intracellular signal transduction
GO:0065008	0.578	regulation of biological quality
GO:2000026	0.546	regulation of multicellular organismal development
GO:0048518	0.505	positive regulation of biological process
GO:0051960	0.462	regulation of nervous system development
GO:0050807	0.457	regulation of synapse organization
GO:0035335	0.446	peptidyl-tyrosine dephosphorylation
GO:0051963	0.418	regulation of synapse assembly
GO:0051961	0.400	negative regulation of nervous system development
GO:1901889	0.379	negative regulation of cell junction assembly
GO:0048522	0.376	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.993	cytoplasm
GO:0005654	0.992	nucleoplasm
GO:0005829	0.973	cytosol
GO:0016020	0.960	membrane
GO:0005886	0.952	plasma membrane
GO:0005576	0.938	extracellular region
GO:0043232	0.921	intracellular non-membrane-bounded organelle
GO:0120025	0.871	plasma membrane bounded cell projection
GO:0031982	0.784	vesicle
GO:0005615	0.762	extracellular space
GO:0043230	0.755	extracellular organelle
GO:1903561	0.675	extracellular vesicle
GO:0070062	0.542	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.992	Phosphoric monoester hydrolases.
RHEA:10684	0.984	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.984	protein-tyrosine-phosphatase.

[back to server]