StarFunc result for job id Q12929

User Input

>input (822 residues)
MNGHISNHPSSFGMYPSQMNGYGSSPTFSQTDREHGSKTSAKALYEQRKNYARDSVSSVS
DISQYRVEHLTTFVLDRKDAMITVDDGIRKLKLLDAKGKVWTQDMILQVDDRAVSLIDLE
SKNELENFPLNTIQHCQAVMHSCSYDSVLALVCKEPTQNKPDLHLFQCDEVKANLISEDI
ESAISDSKGGKQKRRPDALRMISNADPSIPPPPRAPAPAPPGTVTQVDVRSRVAAWSAWA
ADQGDFEKPRQYHEQEETPEMMAARIDRDVQILNHILDDIEFFITKLQKAAEAFSELSKR
KKNKKGKRKGPGEGVLTLRAKPPPPDEFLDCFQKFKHGFNLLAKLKSHIQNPSAADLVHF
LFTPLNMVVQATGGPELASSVLSPLLNKDTIDFLNYTVNGDERQLWMSLGGTWMKARAEW
PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHS
SVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKY
DFVARNNSELSVLKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRPPESGLGRADP
PYTHTIQKQRMEYGPRPADTPPAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANITRQNSS
SSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVIN
ITYDSTPEDVKTWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVYSQITVQ
KAALEDSSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1M3L7	0.696	0.696	0.000	822	0.903	0.903	F1M3L7.pdb.gz	EPS8_RAT Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2
2	AFDB:Q99K30	0.433	0.480	8.075E-63	729	0.395	0.446	Q99K30.pdb.gz	ES8L2_MOUSE Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1
3	AFDB:Q8TE68	0.393	0.443	2.730E-57	723	0.343	0.390	Q8TE68.pdb.gz	ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3
4	AFDB:Q8TE67	0.194	0.264	2.590E-44	593	0.241	0.334	Q8TE67.pdb.gz	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
5	AFDB:Q8IPW1	0.361	0.368	2.408E-37	805	0.245	0.250	Q8IPW1.pdb.gz	Q8IPW1_DROME Arouser, isoform A OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
6	AFDB:Q00647	0.090	0.062	1.843E-7	1249	0.109	0.072	Q00647.pdb.gz	MYO1_EMENI Myosin-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=myoA PE=1 SV=2
7	AFDB:E9PCM6	0.096	0.100	2.807E-7	768	0.089	0.095	E9PCM6.pdb.gz	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
8	AFDB:E7EQN5	0.084	0.076	2.959E-7	925	0.095	0.084	E7EQN5.pdb.gz	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
9	AFDB:A0A0G2JVF0	0.123	0.111	3.287E-7	955	0.100	0.086	A0A0G2JVF0.pdb.gz	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
10	AFDB:X2JAU8	0.097	0.079	2.995E-6	1075	0.109	0.084	X2JAU8.pdb.gz	NWK_DROME Protein nervous wreck OS=Drosophila melanogaster OX=7227 GN=nwk PE=1 SV=1
11	PDB:3qwyA	0.070	0.325	8.800E-5	170	0.022	0.106	3qwyA.pdb.gz
12	PDB:1k9aB	0.067	0.123	2.152E-4	441	0.019	0.036	1k9aB.pdb.gz
13	PDB:2eyzA	0.075	0.194	2.268E-4	304	0.026	0.069	2eyzA.pdb.gz
14	PDB:7c3mA	0.121	0.166	8.451E-4	577	0.023	0.033	7c3mA.pdb.gz
15	PDB:3uzsA	0.090	0.117	1.159E-3	609	0.024	0.033	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
16	PDB:7mp5A	0.101	0.054	1.507E-3	1629	0.047	0.024	7mp5A.pdb.gz
17	PDB:4mk0A	0.103	0.132	1.860E-3	631	0.018	0.024	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:3ehqA	0.066	0.285	1.961E-3	182	0.021	0.093	3ehqA.pdb.gz
19	PDB:1griA	0.074	0.280	2.067E-3	211	0.018	0.071	1griA.pdb.gz
20	PDB:2h8hA	0.063	0.115	3.498E-3	445	0.019	0.036	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M3L7	0.0	1399	822	0.904	0.904	EPS8_RAT Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2
2	Q08509	0.0	1383	821	0.891	0.892	EPS8_MOUSE Epidermal growth factor receptor kinase substrate 8 OS=Mus musculus OX=10090 GN=Eps8 PE=1 SV=2
3	Q12929	0.0	1707	822	1.000	1.000	EPS8_HUMAN Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8 PE=1 SV=1
4	Q9H6S3	1.31e-179	535	715	0.393	0.452	ES8L2_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=2
5	A0A3B3ISQ4	4.40e-175	526	788	0.393	0.410	A0A3B3ISQ4_HUMAN EPS8 like 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=1
6	Q99K30	1.54e-148	455	729	0.320	0.361	ES8L2_MOUSE Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1
7	Q8TE68	1.31e-108	351	723	0.259	0.295	ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3
8	Q8TE67	8.53e-72	248	593	0.215	0.298	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
9	G5EFE0	9.40e-50	189	740	0.157	0.174	G5EFE0_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant B OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
10	G5ED33	4.39e-49	189	917	0.157	0.141	G5ED33_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant A OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
11	O18250	8.42e-49	188	862	0.157	0.150	O18250_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=3
12	Q7YTG1	9.41e-49	187	845	0.157	0.153	Q7YTG1_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=2
13	Q9U3Z9	2.01e-41	165	778	0.109	0.116	Q9U3Z9_DROME Arouser OS=Drosophila melanogaster OX=7227 GN=aru PE=2 SV=1
14	Q9VPU7	2.01e-41	165	778	0.109	0.116	Q9VPU7_DROME Arouser, isoform C OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
15	Q8IPW1	2.93e-41	164	805	0.109	0.112	Q8IPW1_DROME Arouser, isoform A OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
16	Q7YTG2	2.80e-32	136	665	0.092	0.114	Q7YTG2_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=2
17	E7ERP6	2.34e-08	53.9	83	0.026	0.253	E7ERP6_HUMAN NCK adaptor protein 2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=1
18	C9JVV5	3.74e-08	55.1	129	0.027	0.171	C9JVV5_HUMAN NCK adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=NCK1 PE=1 SV=1
19	Q95PW9	5.13e-08	58.5	395	0.035	0.073	Q95PW9_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2
20	Q95PX0	5.21e-08	58.5	397	0.035	0.073	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	0.0051	28.3	Phosphotyrosine interaction domain (PTB/PID)
2	PF08416 PTB	7.8e-53	189.5	Phosphotyrosine-binding domain
3	PF18016 SAM_3	1.1e-18	78.3	SAM domain (Sterile alpha motif)
4	PF02198 SAM_PNT	3.5e+02	12.6	Sterile alpha motif (SAM)/Pointed domain
5	PF00018 SH3_1	2.7e-07	41.4	SH3 domain
6	PF07653 SH3_2	0.044	24.9	Variant SH3 domain
7	PF08239 SH3_3	11	17.9	Bacterial SH3 domain
8	PF14604 SH3_9	0.00031	31.9	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281172

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316338	0.999	Brain-specific angiogenesis inhibitor 1-associated protein 2
2	9606.ENSP00000365312	0.999	Abl interactor 1
3	9606.ENSP00000387784	0.999	Son of sevenless homolog 1
4	9606.ENSP00000277575	0.998	USP6 N-terminal-like protein
5	9606.ENSP00000275493	0.996	Epidermal growth factor receptor
6	9606.ENSP00000383118	0.977	Cell division control protein 42 homolog
7	9606.ENSP00000354623	0.972	Whirlin
8	9606.ENSP00000273047	0.959	Ras-related protein Rab-5A
9	9606.ENSP00000425556	0.947	Palladin
10	9606.ENSP00000367408	0.938	Peripheral plasma membrane protein CASK
11	9606.ENSP00000265171	0.934	Pro-epidermal growth factor
12	9606.ENSP00000348461	0.934	Ras-related C3 botulinum toxin substrate 1
13	9606.ENSP00000428056	0.921	Phosphatidylinositol 3-kinase regulatory subunit alpha
14	9606.ENSP00000005260	0.918	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
15	9606.ENSP00000361423	0.918	Tyrosine-protein kinase ABL1
16	9606.ENSP00000289153	0.915	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
17	9606.ENSP00000263967	0.912	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
18	9606.ENSP00000352121	0.907	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
19	9606.ENSP00000480157	0.900	Phosphoinositide 3-kinase regulatory subunit 6
20	9606.ENSP00000205890	0.850	Unconventional myosin-XV

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0008092	0.983	cytoskeletal protein binding
GO:0003779	0.973	actin binding
GO:0030234	0.957	enzyme regulator activity
GO:0044877	0.908	protein-containing complex binding
GO:0045296	0.740	cadherin binding
GO:0140677	0.533	molecular function activator activity
GO:0005085	0.493	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0051128	0.995	regulation of cellular component organization
GO:1902903	0.994	regulation of supramolecular fiber organization
GO:0016043	0.989	cellular component organization
GO:0048523	0.983	negative regulation of cellular process
GO:0033043	0.981	regulation of organelle organization
GO:0110053	0.967	regulation of actin filament organization
GO:0044087	0.960	regulation of cellular component biogenesis
GO:0065008	0.959	regulation of biological quality
GO:0051129	0.957	negative regulation of cellular component organization
GO:0030029	0.947	actin filament-based process
GO:0006996	0.942	organelle organization
GO:1902904	0.942	negative regulation of supramolecular fiber organization
GO:0043254	0.941	regulation of protein-containing complex assembly
GO:0030036	0.927	actin cytoskeleton organization
GO:0050896	0.926	response to stimulus
GO:0007015	0.921	actin filament organization
GO:0008064	0.872	regulation of actin polymerization or depolymerization
GO:0022607	0.869	cellular component assembly
GO:0031333	0.869	negative regulation of protein-containing complex assembly
GO:0051494	0.869	negative regulation of cytoskeleton organization
GO:0032272	0.857	negative regulation of protein polymerization
GO:0030833	0.854	regulation of actin filament polymerization
GO:0032501	0.830	multicellular organismal process
GO:0051716	0.817	cellular response to stimulus
GO:0030837	0.817	negative regulation of actin filament polymerization
GO:1901879	0.785	regulation of protein depolymerization
GO:0030835	0.777	negative regulation of actin filament depolymerization
GO:0051693	0.761	actin filament capping
GO:0007154	0.749	cell communication
GO:0007165	0.736	signal transduction
GO:0048518	0.594	positive regulation of biological process
GO:0048522	0.556	positive regulation of cellular process
GO:0051017	0.444	actin filament bundle assembly
GO:0042221	0.391	response to chemical
GO:0035556	0.379	intracellular signal transduction
GO:0048583	0.321	regulation of response to stimulus
GO:0007265	0.309	Ras protein signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.998	membrane-bounded organelle
GO:0030054	0.993	cell junction
GO:0005886	0.992	plasma membrane
GO:0005829	0.992	cytosol
GO:0005576	0.991	extracellular region
GO:0032991	0.988	protein-containing complex
GO:0031982	0.988	vesicle
GO:0005615	0.976	extracellular space
GO:1903561	0.973	extracellular vesicle
GO:0043229	0.955	intracellular organelle
GO:0045202	0.939	synapse
GO:0043231	0.929	intracellular membrane-bounded organelle
GO:0070062	0.925	extracellular exosome
GO:0098984	0.918	neuron to neuron synapse
GO:0099572	0.875	postsynaptic specialization
GO:0032279	0.874	asymmetric synapse
GO:0014069	0.844	postsynaptic density
GO:0098978	0.798	glutamatergic synapse
GO:0120025	0.769	plasma membrane bounded cell projection
GO:0012505	0.538	endomembrane system
GO:0070013	0.505	intracellular organelle lumen
GO:0031981	0.472	nuclear lumen
GO:0043005	0.471	neuron projection
GO:0098858	0.411	actin-based cell projection
GO:0098590	0.410	plasma membrane region
GO:0031252	0.397	cell leading edge
GO:0070161	0.394	anchoring junction
GO:0032587	0.337	ruffle membrane
GO:0098862	0.326	cluster of actin-based cell projections

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]