StarFunc result for job id Q12931

User Input

>input (704 residues)
MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFS
TQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNA
SDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGS
KAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFE
IAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELG
SSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ
RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQL
TSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLR
EFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRAS
EPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJY2	0.910	0.910	0.000	704	1.000	1.000	A0A140VJY2.pdb.gz	A0A140VJY2_HUMAN Testicular tissue protein Li 209 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q5XHZ0	0.914	0.911	0.000	706	0.884	0.881	Q5XHZ0.pdb.gz	TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus OX=10116 GN=Trap1 PE=1 SV=1
3	AFDB:A0A2R8RKV0	0.934	0.842	2.679E-100	782	0.750	0.675	A0A2R8RKV0.pdb.gz	A0A2R8RKV0_DANRE TNF receptor-associated protein 1 OS=Danio rerio OX=7955 GN=trap1 PE=1 SV=1
4	PDB:7kclB	0.834	0.952	5.333E-96	614	0.866	0.993	7kclB.pdb.gz	Cryo-EM reveals the dynamic interplay between mitochondrial Hsp90 and SdhB folding intermediates
5	PDB:5tthB	0.843	0.954	1.954E-87	621	0.699	0.792	5tthB.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
6	PDB:5tthA	0.726	0.758	2.764E-81	671	0.685	0.718	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.
7	AFDB:A1Z6L9	0.853	0.869	2.795E-78	691	0.477	0.486	A1Z6L9.pdb.gz	A1Z6L9_DROME FI21274p1 OS=Drosophila melanogaster OX=7227 GN=Trap1 PE=1 SV=1
8	AFDB:Q86L04	0.842	0.834	6.427E-67	711	0.403	0.399	Q86L04.pdb.gz	TRAP1_DICDI TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=trap1 PE=2 SV=1
9	AFDB:Q386P5	0.797	0.747	6.135E-61	753	0.408	0.381	Q386P5.pdb.gz	Q386P5_TRYB2 Heat shock protein, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0250 PE=3 SV=1
10	AFDB:Q728G0	0.786	0.865	9.493E-56	637	0.315	0.349	Q728G0.pdb.gz	HTPG_DESVH Chaperone protein HtpG OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=htpG PE=1 SV=1
11	AFDB:P54651	0.760	0.764	4.659E-53	700	0.295	0.297	P54651.pdb.gz	HSC90_DICDI Heat shock cognate 90 kDa protein OS=Dictyostelium discoideum OX=44689 GN=hspD PE=1 SV=2
12	AFDB:F4JFN3	0.733	0.653	1.309E-52	799	0.320	0.282	F4JFN3.pdb.gz	HS906_ARATH Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP90-6 PE=1 SV=1
13	AFDB:A0A024RD80	0.737	0.718	3.861E-52	724	0.298	0.290	A0A024RD80.pdb.gz
14	PDB:5fwkA	0.754	0.826	1.363E-49	638	0.294	0.324	5fwkA.pdb.gz	Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
15	PDB:7kw7B	0.669	0.741	1.149E-46	628	0.297	0.333	7kw7B.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
16	PDB:2iopA	0.479	0.539	5.155E-43	618	0.303	0.345	2iopA.pdb.gz	Structural Analysis of E. coli hsp90 reveals dramatic nucleotide-dependent conformational rearrangements.
17	PDB:2cg9B	0.730	0.824	6.924E-43	618	0.305	0.348	2cg9B.pdb.gz	Crystal Structure of an Hsp90-Nucleotide-P23/Sba1 Closed Chaperone Complex
18	PDB:1y4uB	0.336	0.504	3.272E-33	454	0.244	0.379	1y4uB.pdb.gz
19	PDB:7p8vA	0.325	0.625	1.049E-11	331	0.071	0.151	7p8vA.pdb.gz	MutL binds to 3' resected DNA ends and blocks DNA polymerase access.
20	PDB:6rkwD	0.327	0.299	2.971E-10	781	0.119	0.108	6rkwD.pdb.gz	Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJY2	0.0	1455	704	1.000	1.000	A0A140VJY2_HUMAN Testicular tissue protein Li 209 OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A2R8RKV0	0.0	1102	782	0.741	0.668	A0A2R8RKV0_DANRE TNF receptor-associated protein 1 OS=Danio rerio OX=7955 GN=trap1 PE=1 SV=1
3	A1Z6L9	0.0	689	691	0.483	0.492	A1Z6L9_DROME FI21274p1 OS=Drosophila melanogaster OX=7227 GN=Trap1 PE=1 SV=1
4	A8WFV1	0.0	1099	719	0.741	0.726	A8WFV1_DANRE Heat shock protein 75 kDa, mitochondrial OS=Danio rerio OX=7955 GN=fc85a11 PE=1 SV=1
5	F1Q9X9	0.0	1099	719	0.741	0.726	F1Q9X9_DANRE TNF receptor-associated protein 1 OS=Danio rerio OX=7955 GN=trap1 PE=1 SV=2
6	I3L0K7	0.0	1029	495	0.703	1.000	I3L0K7_HUMAN TNF receptor associated protein 1 OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=1
7	Q12931	0.0	1455	704	1.000	1.000	TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens OX=9606 GN=TRAP1 PE=1 SV=3
8	Q5XHZ0	0.0	1280	706	0.885	0.882	TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus OX=10116 GN=Trap1 PE=1 SV=1
9	Q7KNF3	0.0	689	686	0.483	0.496	Q7KNF3_DROME Hsp90-related protein TRAP1 OS=Drosophila melanogaster OX=7227 GN=Trap1 PE=2 SV=1
10	Q86L04	0.0	558	711	0.408	0.404	TRAP1_DICDI TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=trap1 PE=2 SV=1
11	Q8IHC2	0.0	692	690	0.487	0.497	Q8IHC2_DROME AT15050p OS=Drosophila melanogaster OX=7227 GN=Trap1 PE=2 SV=1
12	Q9CQN1	0.0	1281	706	0.885	0.882	TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus OX=10090 GN=Trap1 PE=1 SV=1
13	Q386P5	9.67e-173	514	753	0.408	0.381	Q386P5_TRYB2 Heat shock protein, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0250 PE=3 SV=1
14	P0A6Z3	4.42e-124	384	624	0.325	0.367	HTPG_ECOLI Chaperone protein HtpG OS=Escherichia coli (strain K12) OX=83333 GN=htpG PE=1 SV=1
15	Q728G0	2.32e-123	383	637	0.328	0.363	HTPG_DESVH Chaperone protein HtpG OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=htpG PE=1 SV=1
16	Q8MSU6	5.06e-119	362	349	0.263	0.530	Q8MSU6_DROME LD43460p OS=Drosophila melanogaster OX=7227 GN=Trap1 PE=2 SV=1
17	P54651	3.98e-118	372	700	0.307	0.309	HSC90_DICDI Heat shock cognate 90 kDa protein OS=Dictyostelium discoideum OX=44689 GN=hspD PE=1 SV=2
18	Q9SIF2	2.27e-113	361	780	0.330	0.297	HS905_ARATH Heat shock protein 90-5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=HSP90-5 PE=1 SV=1
19	F4JFN3	5.46e-111	355	799	0.317	0.279	HS906_ARATH Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=HSP90-6 PE=1 SV=1
20	P30946	5.23e-109	347	694	0.298	0.303	HS90A_RABIT Heat shock protein HSP 90-alpha OS=Oryctolagus cuniculus OX=9986 GN=HSP90AA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02518 HATPase_c	7.8e-06	37.7	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
2	PF13589 HATPase_c_3	2e-07	42.5	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF00183 HSP90	1.2e-98	343.1	Hsp90 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367208	0.991	Protein SGT1 homolog
2	9606.ENSP00000373620	0.986	60 kDa heat shock protein, mitochondrial
3	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
4	9606.ENSP00000264932	0.937	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
5	9606.ENSP00000364649	0.918	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
6	9606.ENSP00000364699	0.910	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
7	9606.ENSP00000356953	0.904	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
8	9606.ENSP00000216479	0.899	Activator of 90 kDa heat shock protein ATPase homolog 1
9	9606.ENSP00000307786	0.867	Cytochrome c
10	9606.ENSP00000305790	0.866	Splicing factor 3B subunit 3
11	9606.ENSP00000364204	0.864	Serine/threonine-protein kinase PINK1, mitochondrial
12	9606.ENSP00000377970	0.861	Activator of 90 kDa heat shock protein ATPase homolog 2
13	9606.ENSP00000297185	0.846	Stress-70 protein, mitochondrial
14	9606.ENSP00000367446	0.814	Exostosin-1
15	9606.ENSP00000215829	0.813	Small nuclear ribonucleoprotein Sm D3
16	9606.ENSP00000215793	0.812	Splicing factor 3A subunit 1
17	9606.ENSP00000263697	0.811	DnaJ homolog subfamily C member 8
18	9606.ENSP00000379032	0.800	Exostosin-2
19	9606.ENSP00000229239	0.796	Glyceraldehyde-3-phosphate dehydrogenase
20	9606.ENSP00000258962	0.792	Serine/arginine-rich splicing factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.997	protein kinase binding
GO:1901363	0.937	heterocyclic compound binding
GO:0097159	0.937	organic cyclic compound binding
GO:0003676	0.814	nucleic acid binding
GO:0003723	0.750	RNA binding
GO:0003824	0.680	catalytic activity
GO:0043167	0.660	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0048519	0.869	negative regulation of biological process
GO:0048523	0.696	negative regulation of cellular process
GO:0019222	0.650	regulation of metabolic process
GO:0060255	0.471	regulation of macromolecule metabolic process
GO:0008152	0.470	metabolic process
GO:0031323	0.457	regulation of cellular metabolic process
GO:0080090	0.452	regulation of primary metabolic process
GO:0051171	0.449	regulation of nitrogen compound metabolic process
GO:0044238	0.414	primary metabolic process
GO:0071704	0.393	organic substance metabolic process
GO:0048518	0.375	positive regulation of biological process
GO:0050896	0.317	response to stimulus
GO:0044237	0.311	cellular metabolic process
GO:0006457	0.308	protein folding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005739	0.999	mitochondrion
GO:0005634	0.995	nucleus
GO:0005654	0.978	nucleoplasm
GO:0016020	0.925	membrane
GO:0005829	0.681	cytosol
GO:0031090	0.552	organelle membrane
GO:0032991	0.378	protein-containing complex
GO:0005759	0.319	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]