StarFunc result for job id Q12933

User Input

>input (501 residues)
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8H5	0.479	0.479	2.242E-95	501	1.000	1.000	A0A024R8H5.pdb.gz
2	AFDB:P39429	0.816	0.816	2.681E-91	501	0.868	0.868	P39429.pdb.gz	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
3	AFDB:Q6DEG0	0.353	0.310	2.483E-49	573	0.377	0.330	Q6DEG0.pdb.gz	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
4	AFDB:O00463	0.343	0.309	1.803E-48	557	0.341	0.307	O00463.pdb.gz	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
5	AFDB:Q13114	0.374	0.332	2.088E-47	568	0.361	0.319	Q13114.pdb.gz	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
6	AFDB:P70191	0.340	0.306	3.529E-47	558	0.331	0.297	P70191.pdb.gz	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
7	AFDB:Q6DJN2	0.381	0.346	1.208E-40	556	0.277	0.250	Q6DJN2.pdb.gz	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
8	AFDB:Q9Y4K3	0.348	0.336	3.451E-40	522	0.279	0.268	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
9	AFDB:E1C626	0.329	0.308	3.165E-39	545	0.269	0.248	E1C626.pdb.gz	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
10	AFDB:B5DF45	0.375	0.357	3.556E-39	530	0.277	0.262	B5DF45.pdb.gz	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
11	PDB:5dkaA	0.103	0.494	1.733E-4	96	0.044	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:6xwvD	0.061	0.175	2.768E-2	123	0.034	0.138	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
13	PDB:1j3pA	0.097	0.198	6.262E-2	187	0.032	0.086	1j3pA.pdb.gz	Characterization of the cupin-type phosphoglucose isomerase from the hyperthermophilic archaeon Thermococcus litoralis(1).
14	PDB:4r8pL	0.132	0.249	6.262E-2	254	0.046	0.091	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:3ghgI	0.089	0.110	7.908E-2	394	0.070	0.089	3ghgI.pdb.gz	Crystal structure of human fibrinogen.
16	PDB:7qcdC	0.112	0.201	8.886E-2	267	0.020	0.037	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:5gm6a	0.092	0.333	9.985E-2	123	0.030	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
18	PDB:6xwuA	0.053	0.132	9.985E-2	138	0.038	0.138	6xwuA.pdb.gz
19	PDB:3w40A	0.083	0.168	1.058E-1	199	0.026	0.065	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:7bhqB	0.077	0.133	1.189E-1	204	0.050	0.123	7bhqB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DFH7	0.0	902	497	0.866	0.873	B5DFH7_RAT TNF receptor-associated factor OS=Rattus norvegicus OX=10116 GN=Traf2 PE=1 SV=1
2	P39429	0.0	912	501	0.868	0.868	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
3	Q12933	0.0	1036	501	1.000	1.000	TRAF2_HUMAN TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2
4	B1AMX8	4.81e-139	400	193	0.385	1.000	B1AMX8_HUMAN TNF receptor associated factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=1
5	B1AMX7	1.11e-120	352	171	0.341	1.000	B1AMX7_HUMAN TNF receptor associated factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=8
6	Q6DEG0	3.00e-93	296	573	0.385	0.337	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
7	Q60803	4.37e-92	293	567	0.381	0.337	TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2
8	Q13114	1.96e-91	291	568	0.371	0.327	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
9	O00463	2.02e-90	288	557	0.349	0.314	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
10	P70191	2.16e-88	283	558	0.359	0.323	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
11	Q13077	3.03e-88	278	416	0.315	0.380	TRAF1_HUMAN TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1
12	P39428	4.44e-88	278	409	0.307	0.377	TRAF1_MOUSE TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2
13	Q4VA12	3.31e-86	273	409	0.303	0.372	Q4VA12_MOUSE TNF receptor-associated factor OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=1
14	Q7T1K2	5.97e-60	206	470	0.285	0.304	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
15	E1C626	7.03e-59	205	545	0.285	0.262	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
16	Q9BUZ4	1.07e-58	203	470	0.295	0.315	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
17	Q6DJN2	1.73e-58	204	556	0.293	0.264	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
18	Q61382	7.04e-58	201	470	0.311	0.332	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
19	B5DF45	7.60e-58	202	530	0.299	0.283	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
20	P70196	4.75e-56	197	530	0.289	0.274	TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00917 MATH	65	15.1	MATH domain
2	PF04102 SlyX	3.8e+02	13.1	SlyX
3	PF16673 TRAF_BIRC3_bd	3.4e-27	105.3	TNF receptor-associated factor BIRC3 binding domain
4	PF00097 zf-C3HC4	0.0069	27.6	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	5.5	18.2	Zinc finger, C3HC4 type (RING finger)
6	PF14835 zf-RING_6	13	17.0	zf-RING of BARD1-type protein
7	PF02176 zf-TRAF	2e-15	68.5	TRAF-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247668

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000162749	0.999	Tumor necrosis factor receptor superfamily member 1A
2	9606.ENSP00000259808	0.999	Receptor-interacting serine/threonine-protein kinase 1
3	9606.ENSP00000263464	0.999	Baculoviral IAP repeat-containing protein 3
4	9606.ENSP00000341268	0.999	Tumor necrosis factor receptor type 1-associated DEATH domain protein
5	9606.ENSP00000351908	0.999	Mitogen-activated protein kinase kinase kinase 5
6	9606.ENSP00000361359	0.999	Tumor necrosis factor receptor superfamily member 5
7	9606.ENSP00000401445	0.999	Serine/threonine-protein kinase/endoribonuclease IRE1
8	9606.ENSP00000477613	0.999	Baculoviral IAP repeat-containing protein 2
9	9606.ENSP00000362994	0.998	TNF receptor-associated factor 1
10	9606.ENSP00000365435	0.998	Tumor necrosis factor receptor superfamily member 1B
11	9606.ENSP00000398698	0.998	Tumor necrosis factor
12	9606.ENSP00000259371	0.997	Disabled homolog 2-interacting protein
13	9606.ENSP00000359424	0.997	Inhibitor of nuclear factor kappa-B kinase subunit alpha
14	9606.ENSP00000478699	0.997	Tumor necrosis factor receptor superfamily member 9
15	9606.ENSP00000356426	0.996	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
16	9606.ENSP00000351273	0.995	Caspase-8
17	9606.ENSP00000401980	0.995	Mitochondrial antiviral-signaling protein
18	9606.ENSP00000301838	0.994	FAS-associated death domain protein
19	9606.ENSP00000430684	0.994	Inhibitor of nuclear factor kappa-B kinase subunit beta
20	9606.ENSP00000326737	0.993	Tumor necrosis factor receptor superfamily member 12A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032813	1.000	tumor necrosis factor receptor superfamily binding
GO:0019899	0.999	enzyme binding
GO:0019900	0.915	kinase binding
GO:0042802	0.892	identical protein binding
GO:0019901	0.887	protein kinase binding
GO:0044389	0.781	ubiquitin-like protein ligase binding
GO:0044877	0.741	protein-containing complex binding
GO:0031625	0.718	ubiquitin protein ligase binding
GO:0140096	0.530	catalytic activity, acting on a protein
GO:0016740	0.439	transferase activity
GO:0005164	0.378	tumor necrosis factor receptor binding
GO:0019903	0.365	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010941	0.988	regulation of cell death
GO:0051716	0.987	cellular response to stimulus
GO:0009893	0.986	positive regulation of metabolic process
GO:0048584	0.984	positive regulation of response to stimulus
GO:0010604	0.984	positive regulation of macromolecule metabolic process
GO:1902531	0.983	regulation of intracellular signal transduction
GO:0042981	0.982	regulation of apoptotic process
GO:0051246	0.981	regulation of protein metabolic process
GO:0031323	0.980	regulation of cellular metabolic process
GO:0007165	0.980	signal transduction
GO:0051173	0.977	positive regulation of nitrogen compound metabolic process
GO:0002682	0.976	regulation of immune system process
GO:0031399	0.972	regulation of protein modification process
GO:0048519	0.968	negative regulation of biological process
GO:0009967	0.967	positive regulation of signal transduction
GO:0008152	0.963	metabolic process
GO:0010468	0.962	regulation of gene expression
GO:1902533	0.960	positive regulation of intracellular signal transduction
GO:0031325	0.959	positive regulation of cellular metabolic process
GO:0051247	0.958	positive regulation of protein metabolic process
GO:0048523	0.954	negative regulation of cellular process
GO:0065009	0.951	regulation of molecular function
GO:0034612	0.950	response to tumor necrosis factor
GO:0031401	0.949	positive regulation of protein modification process
GO:0008219	0.946	cell death
GO:0071704	0.941	organic substance metabolic process
GO:0012501	0.929	programmed cell death
GO:0051092	0.926	positive regulation of NF-kappaB transcription factor activity
GO:0006807	0.925	nitrogen compound metabolic process
GO:0071356	0.922	cellular response to tumor necrosis factor
GO:0042327	0.910	positive regulation of phosphorylation
GO:0001932	0.907	regulation of protein phosphorylation
GO:0044238	0.905	primary metabolic process
GO:0033674	0.904	positive regulation of kinase activity
GO:0001934	0.903	positive regulation of protein phosphorylation
GO:0033209	0.896	tumor necrosis factor-mediated signaling pathway
GO:0050776	0.892	regulation of immune response
GO:0002684	0.890	positive regulation of immune system process
GO:0043065	0.888	positive regulation of apoptotic process
GO:0045859	0.888	regulation of protein kinase activity
GO:0006950	0.882	response to stress
GO:0001817	0.880	regulation of cytokine production
GO:0060548	0.879	negative regulation of cell death
GO:0043408	0.876	regulation of MAPK cascade
GO:0071900	0.867	regulation of protein serine/threonine kinase activity
GO:0002819	0.865	regulation of adaptive immune response
GO:0035556	0.859	intracellular signal transduction
GO:0010628	0.853	positive regulation of gene expression
GO:1901564	0.852	organonitrogen compound metabolic process
GO:0043170	0.850	macromolecule metabolic process
GO:0019538	0.844	protein metabolic process
GO:0050778	0.842	positive regulation of immune response
GO:0045860	0.842	positive regulation of protein kinase activity
GO:0002822	0.836	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0006915	0.828	apoptotic process
GO:0002718	0.817	regulation of cytokine production involved in immune response
GO:0043066	0.814	negative regulation of apoptotic process
GO:0002699	0.762	positive regulation of immune effector process
GO:0002706	0.745	regulation of lymphocyte mediated immunity
GO:0080134	0.699	regulation of response to stress
GO:0043412	0.650	macromolecule modification
GO:0036211	0.640	protein modification process
GO:0071840	0.537	cellular component organization or biogenesis
GO:0002708	0.536	positive regulation of lymphocyte mediated immunity
GO:0043122	0.526	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0044237	0.519	cellular metabolic process
GO:0016043	0.515	cellular component organization
GO:0051240	0.499	positive regulation of multicellular organismal process
GO:0033554	0.488	cellular response to stress
GO:0043123	0.466	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010605	0.311	negative regulation of macromolecule metabolic process
GO:0009605	0.301	response to external stimulus
GO:0051172	0.300	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0012505	0.997	endomembrane system
GO:0070013	0.976	intracellular organelle lumen
GO:0005654	0.972	nucleoplasm
GO:0032991	0.951	protein-containing complex
GO:0016020	0.933	membrane
GO:0031090	0.858	organelle membrane
GO:0098796	0.673	membrane protein complex
GO:0071944	0.582	cell periphery
GO:0043235	0.442	receptor complex
GO:0005783	0.428	endoplasmic reticulum
GO:1902494	0.384	catalytic complex
GO:0042175	0.373	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.366	organelle subcompartment
GO:0005789	0.354	endoplasmic reticulum membrane
GO:0005886	0.334	plasma membrane
GO:0140534	0.316	endoplasmic reticulum protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.439	Transferases.

[back to server]