StarFunc result for job id Q12934

User Input

>input (665 residues)
MYRRSYVFQTRKEQYEHADEASRAAEPERPADEGWAGATSLAALQGLGERVAAHVQRARA
LEQRHAGLRRQLDAFQRLGELAGPEDALARQVESNRQRVRDLEAERARLERQGTEAQRAL
DEFRSKYENECECQLLLKEMLERLNKEADEALLHNLRLQLEAQFLQDDISAAKDRHKKNL
LEVQTYISILQQIIHTTPPASIVTSGMREEKLLTEREVAALRSQLEEGREVLSHLQAQRV
ELQAQTTTLEQAIKSAHECYDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQ
TLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKDLTRALQDITAAK
PRQKALPKNVPRRKEIITKDKTNGALEDAPLKGLEDTKLVQVVLKEESESKFESESKEVS
PLTQEGAPEDVPDGGQISKGFGKLYRKVKEKVRSPKEPETPTELYTKERHVLVTGDANYV
DPRFYVSSITAKGGVAVSVAEDSVLYDGQVEPSPESPKPPLENGQVGLQEKEDGQPIDQQ
PIDKEIEPDGAELEGPEEKREGEERDEESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEV
LGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKS
GEKSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12934	1.000	1.000	2.217E-98	665	1.000	1.000	Q12934.pdb.gz	BFSP1_HUMAN Filensin OS=Homo sapiens OX=9606 GN=BFSP1 PE=1 SV=3
2	AFDB:A2AMT1	0.473	0.471	7.002E-64	669	0.660	0.656	A2AMT1.pdb.gz	BFSP1_MOUSE Filensin OS=Mus musculus OX=10090 GN=Bfsp1 PE=1 SV=1
3	AFDB:E7ESP9	0.184	0.143	1.536E-13	877	0.211	0.160	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
4	AFDB:A0A0G2K3L9	0.181	0.111	2.141E-11	1226	0.171	0.093	A0A0G2K3L9.pdb.gz	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
5	AFDB:B8QI33	0.176	0.117	4.156E-11	1267	0.173	0.091	B8QI33.pdb.gz	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
6	AFDB:P16884	0.175	0.124	2.985E-9	1072	0.200	0.124	P16884.pdb.gz	NFH_RAT Neurofilament heavy polypeptide OS=Rattus norvegicus OX=10116 GN=Nefh PE=1 SV=4
7	AFDB:F1M8A4	0.141	0.085	1.124E-8	1150	0.167	0.097	F1M8A4.pdb.gz	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
8	AFDB:P12036	0.209	0.145	1.303E-8	1026	0.192	0.125	P12036.pdb.gz	NFH_HUMAN Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH PE=1 SV=4
9	AFDB:B8QI36	0.095	0.059	3.155E-8	1187	0.180	0.101	B8QI36.pdb.gz	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
10	AFDB:P19246	0.198	0.127	4.909E-8	1090	0.203	0.124	P19246.pdb.gz	NFH_MOUSE Neurofilament heavy polypeptide OS=Mus musculus OX=10090 GN=Nefh PE=1 SV=3
11	PDB:7r5jV0	0.076	0.181	7.342E-1	273	0.069	0.168	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:7mqaNA	0.048	0.087	1.230	295	0.039	0.088	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7y4sA	0.102	0.174	2.978	343	0.042	0.082	7y4sA.pdb.gz
14	PDB:7qooK	0.055	0.142	5.780	253	0.053	0.138	7qooK.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
15	PDB:2h3aA	0.035	0.219	8.354	72	0.008	0.069	2h3aA.pdb.gz	Structural Basis for Nucleic Acid and Toxin Recognition of the Bacterial Antitoxin CcdA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AMT1	0.0	829	669	0.677	0.673	BFSP1_MOUSE Filensin OS=Mus musculus OX=10090 GN=Bfsp1 PE=1 SV=1
2	Q12934	0.0	1339	665	1.000	1.000	BFSP1_HUMAN Filensin OS=Homo sapiens OX=9606 GN=BFSP1 PE=1 SV=3
3	P35900	1.07e-09	63.5	424	0.063	0.099	K1C20_HUMAN Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1
4	P07197	2.45e-08	59.7	916	0.107	0.078	NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3
5	Q10758	1.06e-07	57.4	483	0.113	0.155	K2C8_RAT Keratin, type II cytoskeletal 8 OS=Rattus norvegicus OX=10116 GN=Krt8 PE=1 SV=3
6	E7ESP9	1.09e-07	57.8	877	0.107	0.081	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
7	P50446	9.40e-07	54.3	553	0.095	0.114	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
8	E7EMV2	1.50e-06	53.9	698	0.107	0.102	E7EMV2_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
9	Q6PVZ1	2.29e-06	53.1	467	0.105	0.150	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
10	Q92764	2.91e-06	52.8	455	0.093	0.136	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
11	P19001	2.98e-06	52.4	403	0.084	0.139	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
12	Q9PWD8	3.16e-06	52.4	429	0.113	0.175	Q9PWD8_DANRE Type I cytokeratin OS=Danio rerio OX=7955 GN=wu:fa03a08 PE=1 SV=1
13	P07744	3.89e-06	52.4	525	0.083	0.105	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
14	P08553	4.11e-06	52.8	848	0.102	0.080	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
15	Q14532	6.23e-06	51.6	448	0.099	0.147	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
16	P02538	6.80e-06	51.6	564	0.092	0.108	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
17	Q9DCV7	7.46e-06	51.2	457	0.092	0.133	K2C7_MOUSE Keratin, type II cytoskeletal 7 OS=Mus musculus OX=10090 GN=Krt7 PE=1 SV=1
18	A2ATX5	8.28e-06	51.2	474	0.104	0.146	A2ATX5_DANRE Alpha-internexin OS=Danio rerio OX=7955 GN=si:ch211-67n3.6 PE=1 SV=1
19	O76011	8.71e-06	51.2	436	0.089	0.135	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
20	P12839	9.34e-06	51.6	846	0.101	0.079	NFM_RAT Neurofilament medium polypeptide OS=Rattus norvegicus OX=10116 GN=Nefm PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	2.6e-14	65.2	Intermediate filament protein
2	PF04011 LemA	18	16.6	LemA family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367104

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304987	0.995	Phakinin
2	9606.ENSP00000257979	0.977	Lens fiber major intrinsic protein
3	9606.ENSP00000295314	0.903	Tropomodulin-4
4	9606.ENSP00000264009	0.819	Heat shock factor protein 4
5	9606.ENSP00000376287	0.801	Beta-crystallin S
6	9606.ENSP00000484263	0.790	Transmembrane protein 114
7	9606.ENSP00000465930	0.785	Galactokinase
8	9606.ENSP00000358238	0.773	Gap junction alpha-8 protein
9	9606.ENSP00000215939	0.765	Beta-crystallin B1
10	9606.ENSP00000291554	0.762	Crystallin, alpha A
11	9606.ENSP00000482816	0.762	Alpha-crystallin A chain
12	9606.ENSP00000215855	0.757	Beta-crystallin B3
13	9606.ENSP00000241125	0.751	Gap junction alpha-3 protein
14	9606.ENSP00000217402	0.749	Charged multivesicular body protein 4b
15	9606.ENSP00000221973	0.745	Lens intrinsic membrane protein 2
16	9606.ENSP00000346805	0.717	Beta-crystallin A4
17	9606.ENSP00000264376	0.716	Gamma-crystallin D
18	9606.ENSP00000381273	0.713	Beta-crystallin B2
19	9606.ENSP00000359699	0.712	Deoxyribonuclease-2-beta
20	9606.ENSP00000225387	0.699	Beta-crystallin A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005200	1.000	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0045103	0.976	intermediate filament-based process
GO:0032501	0.971	multicellular organismal process
GO:0048856	0.962	anatomical structure development
GO:0016043	0.875	cellular component organization
GO:0007275	0.815	multicellular organism development
GO:0048513	0.792	animal organ development
GO:0006996	0.782	organelle organization
GO:0048880	0.743	sensory system development
GO:0150063	0.665	visual system development
GO:0045104	0.662	intermediate filament cytoskeleton organization
GO:0030154	0.648	cell differentiation
GO:0001654	0.620	eye development
GO:0043010	0.604	camera-type eye development
GO:0002088	0.558	lens development in camera-type eye
GO:0097435	0.511	supramolecular fiber organization
GO:0045109	0.485	intermediate filament organization
GO:0065007	0.398	biological regulation
GO:0050789	0.374	regulation of biological process
GO:0009888	0.314	tissue development
GO:0050794	0.308	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005882	1.000	intermediate filament
GO:0005737	0.983	cytoplasm
GO:0016020	0.869	membrane
GO:0071944	0.647	cell periphery
GO:0043227	0.419	membrane-bounded organelle
GO:0005886	0.410	plasma membrane
GO:0043231	0.356	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]