StarFunc result for job id Q12947

User Input

>input (444 residues)
MTTEGGPPPAPLRRACSPVPGALQAALMSPPPAAAAAAAAAPETTSSSSSSSSASCASSS
SSSNSASAPSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVMAIQSSPSKR
LTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPAS
EFMFEEGSFRRRPRGFRRKCQALKPMYHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQ
GGYGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPGSTYMASCPVPAGPGGVGAA
GGGGGGDYGPDSSSSPVPSSPAMASAIECHSPYTSPAAHWSSPGASPYLKQPPALTPSSN
PAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFH
PSASGSYYHHHHQSVCQDIKPCVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O54743	0.322	0.320	3.827E-58	446	0.939	0.935	O54743.pdb.gz	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
2	AFDB:O60548	0.234	0.211	2.713E-18	495	0.318	0.285	O60548.pdb.gz	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
3	AFDB:B0UXI3	0.216	0.227	4.821E-17	422	0.277	0.291	B0UXI3.pdb.gz	B0UXI3_DANRE Forkhead box E3 OS=Danio rerio OX=7955 GN=foxe3 PE=2 SV=1
4	AFDB:Q9UJU5	0.243	0.228	3.977E-16	478	0.279	0.259	Q9UJU5.pdb.gz	FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens OX=9606 GN=FOXD3 PE=1 SV=1
5	AFDB:Q9PRJ8	0.224	0.281	1.106E-15	352	0.230	0.290	Q9PRJ8.pdb.gz	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
6	AFDB:Q01167	0.237	0.163	1.179E-15	660	0.239	0.161	Q01167.pdb.gz	FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens OX=9606 GN=FOXK2 PE=1 SV=3
7	AFDB:Q9QY14	0.214	0.327	1.429E-15	288	0.227	0.351	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
8	AFDB:Q9DE25	0.238	0.224	2.540E-15	476	0.250	0.233	Q9DE25.pdb.gz	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
9	AFDB:E0XEN6	0.223	0.258	5.472E-15	378	0.223	0.262	E0XEN6.pdb.gz	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
10	AFDB:Q99958	0.212	0.189	7.067E-15	501	0.243	0.216	Q99958.pdb.gz	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
11	PDB:2hdcA	0.182	0.667	1.152E-8	97	0.133	0.608	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:7k5yU	0.120	0.549	2.472E-2	75	0.041	0.240	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:2fe3B	0.120	0.335	3.627E-2	143	0.029	0.091	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
14	PDB:6iwtA	0.130	0.161	4.122E-2	346	0.027	0.035	6iwtA.pdb.gz
15	PDB:2nyxB	0.124	0.335	4.685E-2	147	0.025	0.075	2nyxB.pdb.gz
16	PDB:1fp1D	0.147	0.186	6.875E-2	340	0.023	0.029	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
17	PDB:5k1yD	0.130	0.510	6.875E-2	92	0.029	0.141	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
18	PDB:3euhB	0.162	0.216	7.813E-2	321	0.011	0.016	3euhB.pdb.gz
19	PDB:2qbyB	0.146	0.172	1.303E-1	368	0.027	0.033	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
20	PDB:5h3rA	0.137	0.387	1.389E-1	141	0.025	0.078	5h3rA.pdb.gz	Structural characterization of the DNA-binding mechanism underlying the copper(II)-sensing MarR transcriptional regulator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54743	0.0	579	446	0.860	0.857	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
2	Q12947	0.0	884	444	1.000	1.000	FOXF2_HUMAN Forkhead box protein F2 OS=Homo sapiens OX=9606 GN=FOXF2 PE=1 SV=2
3	E7FER3	1.96e-137	403	429	0.541	0.559	E7FER3_DANRE Forkhead box F2b OS=Danio rerio OX=7955 GN=foxf2b PE=4 SV=1
4	Q61080	9.59e-107	323	378	0.505	0.593	FOXF1_MOUSE Forkhead box protein F1 OS=Mus musculus OX=10090 GN=Foxf1 PE=2 SV=2
5	A1L1S5	2.34e-102	311	380	0.448	0.524	FOXF1_DANRE Forkhead box protein F1 OS=Danio rerio OX=7955 GN=foxf1 PE=2 SV=1
6	Q9W707	2.56e-100	306	372	0.448	0.535	FXF1B_XENLA Forkhead box protein F1-B OS=Xenopus laevis OX=8355 GN=foxf1-b PE=2 SV=1
7	Q12946	5.49e-100	305	379	0.486	0.570	FOXF1_HUMAN Forkhead box protein F1 OS=Homo sapiens OX=9606 GN=FOXF1 PE=1 SV=2
8	Q9VS05	1.36e-43	164	676	0.185	0.121	FOXF_DROME Forkhead box protein biniou OS=Drosophila melanogaster OX=7227 GN=bin PE=1 SV=2
9	P91278	4.55e-42	154	362	0.151	0.185	FOXF_CAEEL Forkhead box protein F OS=Caenorhabditis elegans OX=6239 GN=let-381 PE=1 SV=2
10	Q64731	1.37e-40	149	336	0.142	0.188	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
11	Q7SY22	2.12e-40	150	363	0.144	0.176	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
12	Q9DE25	2.87e-40	152	476	0.158	0.147	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
13	Q12952	1.56e-39	147	345	0.140	0.180	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
14	Q9PVZ3	2.71e-39	149	492	0.146	0.132	FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis OX=8355 GN=foxc1-a PE=2 SV=1
15	Q61850	4.05e-39	149	494	0.146	0.132	FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus OX=10090 GN=Foxc2 PE=1 SV=2
16	Q63246	4.52e-39	149	494	0.146	0.132	FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus OX=10116 GN=Foxc2 PE=1 SV=2
17	Q9DE24	6.91e-39	147	433	0.146	0.150	FXC1B_DANRE Forkhead box C1-B OS=Danio rerio OX=7955 GN=foxc1b PE=2 SV=1
18	Q99958	7.32e-39	148	501	0.146	0.130	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
19	Q12950	1.83e-38	146	439	0.146	0.148	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
20	Q12948	2.83e-38	147	553	0.146	0.118	FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	7.7e-33	123.8	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259806

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370194	0.737	GDP-mannose 4,6 dehydratase
2	9606.ENSP00000386346	0.676	Pulmonary surfactant-associated protein B
3	9606.ENSP00000361547	0.673	Paired mesoderm homeobox protein 2
4	9606.ENSP00000278282	0.649	Uteroglobin
5	9606.ENSP00000239165	0.645	Homeobox protein Hox-B7
6	9606.ENSP00000353785	0.644	Tubulin polymerization-promoting protein
7	9606.ENSP00000375942	0.561	TATA-box-binding protein
8	9606.ENSP00000371875	0.554	Homeobox protein Nkx-3.2
9	9606.ENSP00000359531	0.531	Transcription initiation factor IIB
10	9606.ENSP00000230449	0.520	Exocyst complex component 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.974	protein binding
GO:0000976	0.944	transcription cis-regulatory region binding
GO:0000977	0.715	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.477	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.996	anatomical structure development
GO:0032501	0.995	multicellular organismal process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.989	regulation of metabolic process
GO:0007275	0.983	multicellular organism development
GO:0051252	0.977	regulation of RNA metabolic process
GO:0010468	0.946	regulation of gene expression
GO:0006355	0.942	regulation of DNA-templated transcription
GO:0009987	0.935	cellular process
GO:0048731	0.930	system development
GO:0048513	0.910	animal organ development
GO:0048518	0.885	positive regulation of biological process
GO:0048522	0.863	positive regulation of cellular process
GO:0009893	0.790	positive regulation of metabolic process
GO:0006357	0.767	regulation of transcription by RNA polymerase II
GO:0048519	0.728	negative regulation of biological process
GO:0051173	0.726	positive regulation of nitrogen compound metabolic process
GO:0010604	0.726	positive regulation of macromolecule metabolic process
GO:0009891	0.715	positive regulation of biosynthetic process
GO:0045935	0.715	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.714	positive regulation of RNA metabolic process
GO:0010557	0.712	positive regulation of macromolecule biosynthetic process
GO:0048523	0.697	negative regulation of cellular process
GO:1902680	0.662	positive regulation of RNA biosynthetic process
GO:1903508	0.646	positive regulation of nucleic acid-templated transcription
GO:0045893	0.643	positive regulation of DNA-templated transcription
GO:0050896	0.478	response to stimulus
GO:0051172	0.478	negative regulation of nitrogen compound metabolic process
GO:0010605	0.473	negative regulation of macromolecule metabolic process
GO:0031324	0.458	negative regulation of cellular metabolic process
GO:0045944	0.457	positive regulation of transcription by RNA polymerase II
GO:0051253	0.433	negative regulation of RNA metabolic process
GO:0009890	0.427	negative regulation of biosynthetic process
GO:0045892	0.415	negative regulation of DNA-templated transcription
GO:0009653	0.373	anatomical structure morphogenesis
GO:0009887	0.358	animal organ morphogenesis
GO:0009888	0.319	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.940	intracellular organelle lumen
GO:0031981	0.933	nuclear lumen
GO:0005654	0.889	nucleoplasm
GO:0005737	0.687	cytoplasm
GO:0032991	0.585	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]