StarFunc result for job id Q12948

User Input

>input (553 residues)
MQARYSVSSPNSLGVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGM
ARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQ
GWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAV
KDKEEKDRLHLKEPPPPGRQPPPAPPEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPL
SPAAALGSGSAAAVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADSAPPPPAPSAP
PPHHSQGFSVDNIMTSLRGSPQSAAAELSSGLLASAAASSRAGIAPPLALGAYSPGQSSL
YSSPCSQTSSAGSSGGGGGGAGAAGGAGGAGTYHCNLQAMSLYAAGERGGHLQGAPGGAG
GSAVDDPLPDYSLPPVTSSSSSSLSHGGGGGGGGGGQEAGHHPAAHQGRLTSWYLNQAGG
DLGHLASAAAAAAAAGYPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLY
RTSGAFVYDCSKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12948	0.999	0.999	5.184E-83	553	1.000	1.000	Q12948.pdb.gz	FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3
2	AFDB:P33205	0.189	0.261	5.472E-20	399	0.204	0.283	P33205.pdb.gz	FXA4A_XENLA Forkhead box protein A4-A OS=Xenopus laevis OX=8355 GN=foxa4-a PE=1 SV=3
3	AFDB:O60548	0.184	0.205	6.637E-20	495	0.275	0.307	O60548.pdb.gz	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
4	AFDB:Q9PRJ8	0.198	0.304	8.165E-19	352	0.206	0.324	Q9PRJ8.pdb.gz	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
5	AFDB:O73779	0.194	0.357	1.554E-18	297	0.193	0.360	O73779.pdb.gz	O73779_DANRE Fork head domain protein FKD3 OS=Danio rerio OX=7955 GN=foxb1.2 PE=2 SV=1
6	AFDB:O73781	0.193	0.352	1.767E-18	299	0.181	0.334	O73781.pdb.gz
7	AFDB:Q64732	0.195	0.326	7.281E-18	325	0.186	0.317	Q64732.pdb.gz	FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus OX=10090 GN=Foxb1 PE=2 SV=2
8	AFDB:Q70KY4	0.172	0.170	4.017E-10	559	0.239	0.236	Q70KY4.pdb.gz	FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus OX=10090 GN=Foxo6 PE=1 SV=1
9	PDB:2hdcA	0.152	0.677	4.500E-10	97	0.125	0.711	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
10	AFDB:Q8BUR3	0.150	0.135	1.199E-9	623	0.203	0.180	Q8BUR3.pdb.gz	FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus OX=10090 GN=Foxj3 PE=1 SV=1
11	AFDB:A6ND36	0.066	0.048	4.158E-3	823	0.150	0.101	A6ND36.pdb.gz	FA83G_HUMAN Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2
12	PDB:7k5yU	0.112	0.612	6.518E-2	75	0.024	0.173	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
13	PDB:6zmiCE	0.105	0.672	1.505E-1	72	0.024	0.181	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
14	PDB:3euhB	0.134	0.218	1.947E-1	321	0.016	0.028	3euhB.pdb.gz
15	PDB:4etsB	0.107	0.337	1.947E-1	149	0.018	0.067	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
16	PDB:2nyxB	0.108	0.355	2.361E-1	147	0.020	0.075	2nyxB.pdb.gz
17	PDB:2qbyB	0.108	0.154	2.685E-1	368	0.018	0.027	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
18	PDB:6i6mB	0.109	0.159	3.474E-1	357	0.022	0.034	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
19	PDB:4a6dA	0.100	0.153	3.705E-1	345	0.018	0.029	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
20	PDB:4yrvA	0.080	0.146	3.951E-1	288	0.031	0.059	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12948	0.0	1101	553	1.000	1.000	FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3
2	Q61572	0.0	758	553	0.911	0.911	FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus OX=10090 GN=Foxc1 PE=1 SV=3
3	Q9DE25	0.0	622	476	0.662	0.769	FXC1A_DANRE Forkhead box C1-A OS=Danio rerio OX=7955 GN=foxc1a PE=2 SV=1
4	Q9PVZ3	0.0	581	492	0.671	0.754	FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis OX=8355 GN=foxc1-a PE=2 SV=1
5	W6CJ52	0.0	1101	553	1.000	1.000	W6CJ52_HUMAN Forkhead box C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=4 SV=1
6	Q9DE24	4.46e-174	500	433	0.553	0.707	FXC1B_DANRE Forkhead box C1-B OS=Danio rerio OX=7955 GN=foxc1b PE=2 SV=1
7	Q63246	1.50e-130	392	494	0.501	0.561	FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus OX=10116 GN=Foxc2 PE=1 SV=2
8	Q99958	2.53e-130	391	501	0.503	0.555	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
9	Q61850	7.67e-129	387	494	0.497	0.557	FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus OX=10090 GN=Foxc2 PE=1 SV=2
10	Q9PVY9	4.71e-123	371	465	0.479	0.570	FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis OX=8355 GN=foxc2-a PE=2 SV=1
11	P32027	3.83e-64	219	508	0.188	0.205	CROC_DROME Fork head domain-containing protein crocodile OS=Drosophila melanogaster OX=7227 GN=croc PE=2 SV=2
12	Q64731	5.25e-52	182	336	0.226	0.372	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
13	Q7SY22	8.70e-51	180	363	0.134	0.204	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
14	Q12952	6.82e-50	177	345	0.136	0.217	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
15	P14734	1.94e-48	177	510	0.141	0.153	FKH_DROME Protein fork head OS=Drosophila melanogaster OX=7227 GN=fkh PE=1 SV=1
16	P35583	3.98e-48	175	459	0.141	0.170	FOXA2_MOUSE Hepatocyte nuclear factor 3-beta OS=Mus musculus OX=10090 GN=Foxa2 PE=1 SV=2
17	B0ZTD4	1.42e-47	174	463	0.141	0.168	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
18	Q9Y261	1.87e-47	173	457	0.141	0.171	FOXA2_HUMAN Hepatocyte nuclear factor 3-beta OS=Homo sapiens OX=9606 GN=FOXA2 PE=1 SV=1
19	Q61574	3.29e-47	169	329	0.145	0.243	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
20	Q91765	5.53e-47	172	434	0.132	0.168	FXA2A_XENLA Forkhead box protein A2-A OS=Xenopus laevis OX=8355 GN=foxa2-a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	3.3e-36	134.6	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304169	0.928	Pituitary homeobox 2
2	9606.ENSP00000390436	0.877	Zinc finger protein GLI2
3	9606.ENSP00000405890	0.799	Pre-B-cell leukemia transcription factor 1
4	9606.ENSP00000358866	0.768	Filamin-A
5	9606.ENSP00000325074	0.757	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
6	9606.ENSP00000370194	0.743	GDP-mannose 4,6 dehydratase
7	9606.ENSP00000478561	0.664	Cytochrome P450 1B1
8	9606.ENSP00000300057	0.635	Mesoderm posterior protein 1
9	9606.ENSP00000404100	0.625	Paired box protein Pax-6
10	9606.ENSP00000246080	0.623	Transcription factor 15
11	9606.ENSP00000037502	0.603	Myocilin
12	9606.ENSP00000368632	0.587	Trans-acting T-cell-specific transcription factor GATA-3
13	9606.ENSP00000323588	0.580	Transcription factor SOX-2
14	9606.ENSP00000242261	0.558	Twist-related protein 1
15	9606.ENSP00000380034	0.556	Zinc finger protein SNAI2
16	9606.ENSP00000247182	0.555	Homeobox protein SIX1
17	9606.ENSP00000377721	0.552	COUP transcription factor 2
18	9606.ENSP00000384524	0.550	ETS translocation variant 2
19	9606.ENSP00000238558	0.531	Homeobox protein goosecoid
20	9606.ENSP00000245451	0.526	Bone morphogenetic protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0008134	0.971	transcription factor binding
GO:0061629	0.937	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0008301	0.880	DNA binding, bending
GO:0000987	0.845	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.709	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009889	0.996	regulation of biosynthetic process
GO:0051252	0.996	regulation of RNA metabolic process
GO:0032502	0.995	developmental process
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0009987	0.985	cellular process
GO:0007275	0.980	multicellular organism development
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0048519	0.968	negative regulation of biological process
GO:0048518	0.964	positive regulation of biological process
GO:0050896	0.942	response to stimulus
GO:0048522	0.939	positive regulation of cellular process
GO:0048523	0.938	negative regulation of cellular process
GO:0010604	0.937	positive regulation of macromolecule metabolic process
GO:0051173	0.932	positive regulation of nitrogen compound metabolic process
GO:0031325	0.931	positive regulation of cellular metabolic process
GO:0048731	0.916	system development
GO:0045935	0.916	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.910	positive regulation of RNA metabolic process
GO:0048513	0.908	animal organ development
GO:0009653	0.880	anatomical structure morphogenesis
GO:0006357	0.854	regulation of transcription by RNA polymerase II
GO:0045893	0.840	positive regulation of DNA-templated transcription
GO:0009888	0.826	tissue development
GO:0072359	0.762	circulatory system development
GO:0045944	0.729	positive regulation of transcription by RNA polymerase II
GO:0051716	0.568	cellular response to stimulus
GO:0045595	0.564	regulation of cell differentiation
GO:0009892	0.561	negative regulation of metabolic process
GO:0051239	0.525	regulation of multicellular organismal process
GO:0051172	0.521	negative regulation of nitrogen compound metabolic process
GO:0010605	0.477	negative regulation of macromolecule metabolic process
GO:0031324	0.464	negative regulation of cellular metabolic process
GO:0023052	0.463	signaling
GO:0007154	0.462	cell communication
GO:0048869	0.458	cellular developmental process
GO:0045892	0.454	negative regulation of DNA-templated transcription
GO:0030154	0.453	cell differentiation
GO:0007165	0.430	signal transduction
GO:0009719	0.412	response to endogenous stimulus
GO:0009887	0.394	animal organ morphogenesis
GO:0065009	0.384	regulation of molecular function
GO:0000122	0.308	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.984	cytosol
GO:0043232	0.537	intracellular non-membrane-bounded organelle
GO:0000792	0.347	heterochromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]