StarFunc result for job id Q12950

User Input

>input (439 residues)
MNLPRAERLRSTPQRSLRDSDGEDGKIDVLGEEEDEDEEEAASQQFLEQSLQPGLQVARW
GGVALPREHIEGGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPSSYIALITMAILQS
PHKRLTLSGICAFISDRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGRPGKGNYWSL
DPASQDMFDNGSFLRRRKRFQRHQPTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPAPPQ
PVPGAYPNTGPGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATPAPFPCCSPHLV
LSLGRRARVWRRHREADASLSALRVSCKGSGERVQGLRRVCPRPRGATAPCSSDRQACRT
ILQQQQRHQEEDCANGCAPTKGAVLGGHLSAASALLRYQAVAEGSGLTSLAAPLGGEGTS
PVFLVSPTPSSLAESAGPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12950	0.999	0.999	2.360E-69	439	1.000	1.000	Q12950.pdb.gz	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
2	AFDB:Q3SYB3	0.443	0.465	3.926E-52	417	0.802	0.844	Q3SYB3.pdb.gz	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
3	AFDB:Q9NU39	0.331	0.355	9.832E-46	408	0.690	0.743	Q9NU39.pdb.gz	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
4	AFDB:Q9QY14	0.236	0.355	5.016E-19	288	0.273	0.417	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
5	AFDB:B0UXI3	0.280	0.290	1.403E-17	422	0.267	0.277	B0UXI3.pdb.gz	B0UXI3_DANRE Forkhead box E3 OS=Danio rerio OX=7955 GN=foxe3 PE=2 SV=1
6	AFDB:Q61574	0.260	0.335	1.403E-17	329	0.241	0.322	Q61574.pdb.gz	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
7	AFDB:Q18694	0.233	0.307	2.197E-17	333	0.260	0.342	Q18694.pdb.gz	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
8	AFDB:O54743	0.243	0.240	2.848E-16	446	0.262	0.258	O54743.pdb.gz	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
9	AFDB:P34683	0.258	0.467	3.680E-16	237	0.191	0.354	P34683.pdb.gz	LIN31_CAEEL Protein lin-31 OS=Caenorhabditis elegans OX=6239 GN=lin-31 PE=4 SV=1
10	AFDB:Q64732	0.246	0.329	1.094E-15	325	0.251	0.338	Q64732.pdb.gz	FOXB1_MOUSE Forkhead box protein B1 OS=Mus musculus OX=10090 GN=Foxb1 PE=2 SV=2
11	PDB:2hdcA	0.187	0.682	2.203E-11	97	0.196	0.887	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:4a6dA	0.127	0.158	5.231E-2	345	0.023	0.029	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
13	PDB:6iwtA	0.133	0.163	8.733E-2	346	0.030	0.038	6iwtA.pdb.gz
14	PDB:2nyxB	0.131	0.337	1.058E-1	147	0.023	0.068	2nyxB.pdb.gz
15	PDB:7k5yU	0.137	0.598	1.884E-1	75	0.030	0.173	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
16	PDB:1fp1D	0.148	0.186	2.434E-1	340	0.025	0.032	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
17	PDB:7tjjI	0.154	0.174	2.434E-1	380	0.021	0.024	7tjjI.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.
18	PDB:3euhB	0.161	0.212	2.767E-1	321	0.021	0.028	3euhB.pdb.gz
19	PDB:6qpqD	0.121	0.461	2.767E-1	82	0.032	0.171	6qpqD.pdb.gz
20	PDB:5afqB	0.120	0.119	2.950E-1	444	0.030	0.029	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12950	0.0	880	439	1.000	1.000	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
2	Q3SYB3	0.0	613	417	0.779	0.820	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
3	Q6VB84	0.0	615	417	0.779	0.820	FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens OX=9606 GN=FOXD4L3 PE=1 SV=2
4	Q8WXT5	0.0	605	416	0.772	0.815	FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens OX=9606 GN=FOXD4L4 PE=1 SV=2
5	Q9NU39	1.03e-179	509	408	0.636	0.684	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
6	Q9DEN4	3.92e-56	191	371	0.230	0.272	FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1
7	Q9DEN3	2.76e-54	187	371	0.216	0.256	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
8	Q18694	1.07e-53	184	333	0.205	0.270	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
9	F1R5S7	1.46e-53	185	371	0.253	0.299	F1R5S7_DANRE Forkhead box protein D3 OS=Danio rerio OX=7955 GN=fkd-6 PE=1 SV=1
10	O73784	1.76e-52	181	321	0.235	0.321	O73784_DANRE Fork head domain protein FKD8 OS=Danio rerio OX=7955 GN=fkd8 PE=2 SV=1
11	Q9PRJ8	2.91e-52	181	352	0.207	0.259	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
12	P79772	8.01e-52	181	394	0.205	0.228	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
13	Q9PT68	8.04e-52	180	353	0.207	0.258	FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis OX=8355 GN=foxd5-b PE=2 SV=1
14	Q61060	1.63e-51	182	465	0.205	0.194	FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus OX=10090 GN=Foxd3 PE=2 SV=3
15	Q63245	5.21e-51	169	101	0.180	0.782	FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1
16	Q61345	2.76e-49	176	456	0.180	0.173	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
17	Q9PSY4	3.38e-49	172	345	0.178	0.226	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
18	Q16676	1.24e-48	174	465	0.180	0.170	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
19	O60548	4.21e-48	173	495	0.180	0.160	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2
20	B0UXI3	3.90e-42	155	422	0.155	0.161	B0UXI3_DANRE Forkhead box E3 OS=Danio rerio OX=7955 GN=foxe3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	2e-32	122.5	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371940

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280346	0.661	Dihydrolipoamide S-acetyltransferase
2	9606.ENSP00000190165	0.538	Doublesex- and mab-3-related transcription factor 3
3	9606.ENSP00000325074	0.515	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0003677	0.984	DNA binding
GO:0043565	0.914	sequence-specific DNA binding
GO:0003690	0.626	double-stranded DNA binding
GO:1990837	0.615	sequence-specific double-stranded DNA binding
GO:0000981	0.362	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.982	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0080090	0.936	regulation of primary metabolic process
GO:0009987	0.913	cellular process
GO:0032502	0.877	developmental process
GO:0032501	0.855	multicellular organismal process
GO:0019219	0.849	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.843	regulation of biosynthetic process
GO:0060255	0.799	regulation of macromolecule metabolic process
GO:0031326	0.686	regulation of cellular biosynthetic process
GO:0050896	0.476	response to stimulus
GO:0048856	0.476	anatomical structure development
GO:0010468	0.454	regulation of gene expression
GO:0007275	0.446	multicellular organism development
GO:0008152	0.397	metabolic process
GO:0071704	0.387	organic substance metabolic process
GO:0044238	0.348	primary metabolic process
GO:0048731	0.325	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.968	intracellular organelle lumen
GO:0031981	0.928	nuclear lumen
GO:0005654	0.694	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]