StarFunc result for job id Q12951

User Input

>input (378 residues)
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPN
PYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMK
LVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDC
FKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTASLALEKTESSLPV
DSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSPTSHPLV
TPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHF
YNSVNTSGVLYPREGTEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0XEN6	0.326	0.326	1.211E-55	378	1.000	1.000	E0XEN6.pdb.gz	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
2	AFDB:Q922I5	0.486	0.492	9.907E-51	372	0.839	0.852	Q922I5.pdb.gz	FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus OX=10090 GN=Foxi1 PE=2 SV=2
3	AFDB:Q7ZYQ0	0.368	0.372	1.091E-43	373	0.720	0.729	Q7ZYQ0.pdb.gz	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
4	AFDB:B3DGC2	0.329	0.325	3.496E-36	383	0.582	0.574	B3DGC2.pdb.gz
5	AFDB:A0A2R8QK25	0.357	0.353	7.642E-32	383	0.508	0.501	A0A2R8QK25.pdb.gz
6	AFDB:Q7T2N8	0.344	0.314	5.975E-29	419	0.458	0.413	Q7T2N8.pdb.gz
7	AFDB:Q91904	0.337	0.343	2.100E-28	370	0.452	0.462	Q91904.pdb.gz	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
8	AFDB:Q91905	0.356	0.365	2.700E-28	367	0.460	0.474	Q91905.pdb.gz	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
9	AFDB:Q9PSY4	0.258	0.282	8.699E-18	345	0.254	0.278	Q9PSY4.pdb.gz	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
10	AFDB:Q64731	0.269	0.301	6.499E-17	336	0.294	0.330	Q64731.pdb.gz	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
11	PDB:2hdcA	0.215	0.683	2.288E-9	97	0.164	0.639	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:2nyxB	0.156	0.356	8.854E-2	147	0.021	0.054	2nyxB.pdb.gz
13	PDB:2fe3B	0.149	0.346	9.429E-2	143	0.029	0.077	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
14	PDB:4etsB	0.154	0.345	9.429E-2	149	0.032	0.081	4etsB.pdb.gz	Structure and regulon of Campylobacter jejuni ferric uptake regulator Fur define apo-Fur regulation.
15	PDB:6zmiCE	0.154	0.693	1.139E-1	72	0.034	0.181	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
16	PDB:5k1yD	0.155	0.538	1.212E-1	92	0.024	0.098	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
17	PDB:2xv4S	0.138	0.131	1.768E-1	399	0.048	0.045	2xv4S.pdb.gz
18	PDB:5zr1B	0.152	0.153	1.768E-1	374	0.021	0.021	5zr1B.pdb.gz	Structure of the origin recognition complex bound to DNA replication origin.
19	PDB:5hs7A	0.155	0.454	1.882E-1	102	0.037	0.137	5hs7A.pdb.gz
20	PDB:2qbyB	0.157	0.160	2.004E-1	368	0.032	0.033	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E0XEN6	0.0	763	378	1.000	1.000	E0XEN6_HUMAN Forkhead box I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=4 SV=1
2	Q12951	0.0	763	378	1.000	1.000	FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens OX=9606 GN=FOXI1 PE=1 SV=3
3	Q7ZYQ0	0.0	530	373	0.720	0.729	FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis OX=8355 GN=foxi1e PE=2 SV=1
4	Q922I5	0.0	610	372	0.839	0.852	FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus OX=10090 GN=Foxi1 PE=2 SV=2
5	Q7T1C0	2.01e-126	370	383	0.577	0.569	FXI3B_DANRE Forkhead box protein I3-B OS=Danio rerio OX=7955 GN=foxi3b PE=2 SV=1
6	Q6NY62	1.70e-111	332	383	0.519	0.512	Q6NY62_DANRE Forkhead box I2 OS=Danio rerio OX=7955 GN=foxi2 PE=2 SV=2
7	A3KNJ3	1.24e-109	327	353	0.516	0.552	FXI3A_DANRE Forkhead box protein I3-A OS=Danio rerio OX=7955 GN=foxi3a PE=2 SV=1
8	Q91905	2.19e-96	293	367	0.463	0.477	FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis OX=8355 GN=foxi1-b PE=2 SV=1
9	Q804B2	4.55e-93	285	377	0.450	0.451	Q804B2_DANRE Forkhead box protein I2 OS=Danio rerio OX=7955 GN=cb724 PE=2 SV=1
10	Q91904	5.83e-90	277	370	0.415	0.424	FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis OX=8355 GN=foxi1-a PE=1 SV=1
11	Q63248	2.25e-56	181	101	0.217	0.812	FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxi2 PE=2 SV=1
12	Q7SY22	3.80e-43	155	363	0.183	0.190	Q7SY22_DANRE Forkhead box L1 OS=Danio rerio OX=7955 GN=zgc:63595 PE=2 SV=1
13	Q64731	3.40e-42	152	336	0.164	0.185	FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus OX=10090 GN=Foxl1 PE=2 SV=2
14	Q12952	3.97e-42	152	345	0.167	0.183	FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens OX=9606 GN=FOXL1 PE=2 SV=2
15	Q99958	8.02e-40	149	501	0.206	0.156	FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens OX=9606 GN=FOXC2 PE=1 SV=1
16	Q9PVY9	2.77e-39	147	465	0.164	0.133	FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis OX=8355 GN=foxc2-a PE=2 SV=1
17	Q61850	4.47e-39	147	494	0.177	0.136	FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus OX=10090 GN=Foxc2 PE=1 SV=2
18	Q63246	6.00e-39	147	494	0.177	0.136	FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus OX=10116 GN=Foxc2 PE=1 SV=2
19	Q9PVZ3	6.07e-39	147	492	0.180	0.138	FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis OX=8355 GN=foxc1-a PE=2 SV=1
20	Q12948	1.07e-38	147	553	0.175	0.119	FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens OX=9606 GN=FOXC1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	4e-35	131.1	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304286

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265715	0.779	Pendrin
2	9606.ENSP00000234396	0.695	V-type proton ATPase subunit B, kidney isoform
3	9606.ENSP00000365944	0.646	F-box only protein 6
4	9606.ENSP00000342626	0.611	Eyes absent homolog 1
5	9606.ENSP00000372295	0.609	Gap junction beta-2 protein
6	9606.ENSP00000357068	0.606	ATP-sensitive inward rectifier potassium channel 10
7	9606.ENSP00000304930	0.604	Sclerostin domain-containing protein 1
8	9606.ENSP00000318085	0.603	Histone H4 transcription factor
9	9606.ENSP00000247182	0.594	Homeobox protein SIX1
10	9606.ENSP00000386398	0.592	Putative ankyrin repeat domain-containing protein 30B-like
11	9606.ENSP00000300057	0.591	Mesoderm posterior protein 1
12	9606.ENSP00000263334	0.590	Paired box protein Pax-8
13	9606.ENSP00000368632	0.589	Trans-acting T-cell-specific transcription factor GATA-3
14	9606.ENSP00000308122	0.580	V-type proton ATPase 116 kDa subunit a isoform 4
15	9606.ENSP00000389870	0.563	Homeobox protein DLX-3
16	9606.ENSP00000231656	0.562	Homeobox protein CDX-1
17	9606.ENSP00000292476	0.549	Cleavage and polyadenylation specificity factor subunit 4
18	9606.ENSP00000334122	0.549	Fibroblast growth factor 3
19	9606.ENSP00000265354	0.547	Serum response factor
20	9606.ENSP00000220812	0.543	Dickkopf-related protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0005515	0.942	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0050794	0.974	regulation of cellular process
GO:0006355	0.890	regulation of DNA-templated transcription
GO:0048518	0.881	positive regulation of biological process
GO:0048522	0.854	positive regulation of cellular process
GO:0045944	0.805	positive regulation of transcription by RNA polymerase II
GO:0009987	0.744	cellular process
GO:0048856	0.683	anatomical structure development
GO:0032501	0.423	multicellular organismal process
GO:0007275	0.329	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0005654	0.854	nucleoplasm
GO:0005730	0.685	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]