StarFunc result for job id Q12955

User Input

>input (1400 residues)
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALGIARRLGYISVVDTLKIVTEETMTTTTVTEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVL
RSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRI
KQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFS
PIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDI
TGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKM
NDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGG
QQLVFNFYSFKENRLPFSIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z9Z0	0.437	0.369	0.000	1707	0.557	0.457	D3Z9Z0.pdb.gz	D3Z9Z0_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=2
2	AFDB:G5E8K5	0.576	0.414	0.000	1961	0.957	0.683	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
3	AFDB:O70511	0.578	0.324	0.000	2622	0.976	0.521	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
4	AFDB:P16157	0.517	0.398	0.000	1881	0.610	0.454	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
5	AFDB:Q0KIE7	0.571	0.517	0.000	1549	0.516	0.467	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
6	AFDB:Q9NCP8	0.590	0.708	5.141E-93	1159	0.484	0.584	Q9NCP8.pdb.gz	Q9NCP8_DROME Ankyrin 2 OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
7	AFDB:P97582	0.567	0.929	3.536E-79	843	0.457	0.759	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
8	PDB:8cs9A	0.447	0.776	6.226E-68	796	0.390	0.686	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
9	AFDB:Q3T1J5	0.293	0.463	5.094E-57	880	0.365	0.581	Q3T1J5.pdb.gz	Q3T1J5_RAT Ank3 protein OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=1
10	AFDB:Q3KN55	0.360	0.713	2.091E-44	697	0.251	0.504	Q3KN55.pdb.gz	Q3KN55_DROME Ankyrin 2, isoform E OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
11	AFDB:O15084	0.330	0.419	1.095E-40	1053	0.194	0.257	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
12	PDB:5vkqA	0.379	0.359	2.002E-31	1499	0.178	0.166	5vkqA.pdb.gz
13	PDB:4oauC	0.186	0.362	3.219E-11	692	0.062	0.126	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:2dvwA	0.150	0.880	1.101E-9	229	0.050	0.306	2dvwA.pdb.gz
15	PDB:6aunA	0.164	0.338	2.990E-9	618	0.056	0.126	6aunA.pdb.gz
16	PDB:1wg0A	0.147	0.787	2.205E-8	243	0.046	0.267	1wg0A.pdb.gz
17	PDB:6v9hC	0.154	0.748	2.368E-8	270	0.045	0.233	6v9hC.pdb.gz
18	PDB:6pqpA	0.128	0.280	1.157E-6	615	0.075	0.171	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
19	PDB:6mwqA	0.107	0.300	2.362E-6	493	0.051	0.144	6mwqA.pdb.gz
20	PDB:6jd6B	0.117	0.791	3.142E-6	192	0.034	0.245	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WTF3	914	1643	0.298	0.254	A0A087WTF3_HUMAN Ankyrin 3 (Fragment) OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=1
2	A0A087WZ65	738	973	0.244	0.351	A0A087WZ65_HUMAN Ankyrin 3 (Fragment) OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=1
3	A0A0G2JZ56	2147	4013	0.746	0.260	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
4	A0A0G2K6R9	2128	3998	0.736	0.258	A0A0G2K6R9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
5	A0A0G2KAS9	2165	3980	0.746	0.262	A0A0G2KAS9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
6	A0A0G2KBB9	2087	4017	0.725	0.253	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
7	A0A5F9ZGS5	2136	1871	0.735	0.550	A0A5F9ZGS5_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
8	A0A5F9ZGS7	2109	1827	0.735	0.563	A0A5F9ZGS7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	A0A5F9ZGX3	2155	3972	0.746	0.263	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
10	A0A5F9ZGX8	2120	1830	0.735	0.562	A0A5F9ZGX8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
11	A0A5F9ZGY1	2110	1887	0.735	0.545	A0A5F9ZGY1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
12	A0A5F9ZGY3	2150	3934	0.735	0.262	A0A5F9ZGY3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
13	A0A5F9ZGY4	2147	3848	0.735	0.267	A0A5F9ZGY4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
14	A0A5F9ZGZ1	2110	1943	0.735	0.530	A0A5F9ZGZ1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
15	A0A5F9ZGZ5	2146	3874	0.734	0.265	A0A5F9ZGZ5_HUMAN Ankyrin 2 (Fragment) OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
16	A0A5F9ZH03	1930	1785	0.679	0.533	A0A5F9ZH03_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZH10	887	1005	0.313	0.436	A0A5F9ZH10_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZH17	1927	1879	0.681	0.508	A0A5F9ZH17_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZH18	896	1109	0.313	0.395	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZH19	2157	3895	0.735	0.264	A0A5F9ZH19_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-138	457.5	Ankyrin repeat
2	PF12796 Ank_2	3.1e-144	481.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.6e-111	360.7	Ankyrin repeat
4	PF13637 Ank_4	5.4e-126	420.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.7e-112	376.7	Ankyrin repeats (many copies)
6	PF13650 Asp_protease_2	2.7e+02	13.6	Aspartyl protease
7	PF02887 PK_C	0.83	21.3	Pyruvate kinase, alpha/beta domain
8	PF17809 UPA_2	1.3e-35	133.5	UPA domain
9	PF00791 ZU5	5e-31	118.1	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280772

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263373	0.998	Spectrin beta chain, non-erythrocytic 4
2	9606.ENSP00000344786	0.996	Neurofascin
3	9606.ENSP00000410257	0.996	Sodium channel protein type 5 subunit alpha
4	9606.ENSP00000352035	0.995	Potassium voltage-gated channel subfamily KQT member 2
5	9606.ENSP00000368314	0.995	Neuronal cell adhesion molecule
6	9606.ENSP00000373648	0.995	Potassium voltage-gated channel subfamily KQT member 3
7	9606.ENSP00000364586	0.989	Sodium channel protein type 2 subunit alpha
8	9606.ENSP00000346534	0.976	Sodium channel protein type 8 subunit alpha
9	9606.ENSP00000349259	0.973	Spectrin beta chain, non-erythrocytic 1
10	9606.ENSP00000261769	0.937	Cadherin-1
11	9606.ENSP00000349588	0.916	Ankyrin-2
12	9606.ENSP00000265709	0.906	Ankyrin-1
13	9606.ENSP00000370744	0.888	Inositol 1,4,5-trisphosphate receptor type 2
14	9606.ENSP00000233121	0.884	Microtubule-associated protein RP/EB family member 3
15	9606.ENSP00000303540	0.884	Sodium channel protein type 1 subunit alpha
16	9606.ENSP00000306866	0.878	Gamma-aminobutyric acid receptor-associated protein
17	9606.ENSP00000286827	0.874	T-lymphoma invasion and metastasis-inducing protein 1
18	9606.ENSP00000396915	0.872	Sodium channel subunit beta-1
19	9606.ENSP00000361824	0.862	Spectrin alpha chain, non-erythrocytic 1
20	9606.ENSP00000363435	0.860	Inositol 1,4,5-trisphosphate receptor type 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005200	0.986	structural constituent of cytoskeleton
GO:0044325	0.423	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.936	cellular process
GO:0032502	0.816	developmental process
GO:0071840	0.800	cellular component organization or biogenesis
GO:0016043	0.538	cellular component organization
GO:0032501	0.517	multicellular organismal process
GO:0048856	0.419	anatomical structure development
GO:0065007	0.338	biological regulation
GO:0050789	0.300	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.958	intracellular anatomical structure
GO:0005737	0.910	cytoplasm
GO:0042995	0.907	cell projection
GO:0120025	0.879	plasma membrane bounded cell projection
GO:0043005	0.848	neuron projection
GO:0030054	0.836	cell junction
GO:0030424	0.779	axon
GO:0043226	0.622	organelle
GO:0043229	0.522	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]