StarFunc result for job id Q12962

User Input

>input (218 residues)
MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGG
TGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFL
MQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTA
SGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12962	0.999	0.999	4.209E-30	218	1.000	1.000	Q12962.pdb.gz	TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1
2	PDB:7ktrH	0.408	0.849	5.081E-13	99	0.454	1.000	7ktrH.pdb.gz	Structure of the human SAGA coactivator complex.
3	AFDB:O60171	0.439	0.445	1.886E-10	215	0.294	0.298	O60171.pdb.gz	TAF10_SCHPO Transcription initiation factor TFIID subunit 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf10 PE=3 SV=1
4	AFDB:Q12030	0.416	0.439	1.663E-8	206	0.216	0.228	Q12030.pdb.gz	TAF10_YEAST Transcription initiation factor TFIID subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF10 PE=1 SV=1
5	PDB:6t9iG	0.399	0.611	3.265E-7	140	0.188	0.293	6t9iG.pdb.gz
6	PDB:7edxH	0.278	0.289	2.463E-2	209	0.083	0.086	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
7	PDB:6t9iE	0.311	0.164	3.408E-2	433	0.069	0.035	6t9iE.pdb.gz
8	PDB:1b67A	0.264	0.750	4.418E-2	68	0.083	0.265	1b67A.pdb.gz
9	PDB:7edxk	0.267	0.546	4.418E-2	98	0.064	0.143	7edxk.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
10	PDB:1kx5B	0.284	0.569	5.031E-2	102	0.083	0.176	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
11	PDB:1jfiB	0.274	0.422	5.728E-2	135	0.092	0.148	1jfiB.pdb.gz	Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex.
12	PDB:1bfmA	0.241	0.649	1.967E-1	69	0.087	0.275	1bfmA.pdb.gz
13	PDB:6mzcK	0.276	0.296	1.967E-1	202	0.087	0.094	6mzcK.pdb.gz
14	AFDB:A4D998	0.187	0.183	3.335E-1	223	0.124	0.121	A4D998.pdb.gz	BH075_ARATH Transcription factor bHLH75 OS=Arabidopsis thaliana OX=3702 GN=BHLH75 PE=2 SV=1
15	AFDB:Q5XJ13	0.163	0.068	4.052E-1	739	0.165	0.049	Q5XJ13.pdb.gz	ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio OX=7955 GN=anks6 PE=2 SV=1
16	AFDB:F8VUB0	0.153	0.122	5.254E-1	289	0.151	0.114	F8VUB0.pdb.gz	F8VUB0_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=8
17	AFDB:O49687	0.164	0.078	5.606E-1	589	0.179	0.066	O49687.pdb.gz	MYC4_ARATH Transcription factor MYC4 OS=Arabidopsis thaliana OX=3702 GN=MYC4 PE=1 SV=1
18	AFDB:Q58G10	0.247	0.142	5.606E-1	407	0.161	0.086	Q58G10.pdb.gz	Q58G10_ARATH Transcriptional regulator of RNA polII, SAGA, subunit OS=Arabidopsis thaliana OX=3702 GN=At2g24530 PE=1 SV=1
19	AFDB:F8VZ70	0.160	0.129	8.276E-1	278	0.138	0.108	F8VZ70.pdb.gz	F8VZ70_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=1
20	AFDB:O23077	0.120	0.093	8.831E-1	319	0.147	0.100	O23077.pdb.gz	STKLN_ARATH Transcription factor STKL2 OS=Arabidopsis thaliana OX=3702 GN=STKL2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12962	1.60e-154	429	218	1.000	1.000	TAF10_HUMAN Transcription initiation factor TFIID subunit 10 OS=Homo sapiens OX=9606 GN=TAF10 PE=1 SV=1
2	Q8K0H5	4.45e-137	384	218	0.917	0.917	TAF10_MOUSE Transcription initiation factor TFIID subunit 10 OS=Mus musculus OX=10090 GN=Taf10 PE=1 SV=1
3	Q9XZT7	5.12e-42	141	146	0.303	0.452	TAFAB_DROME Transcription initiation factor TFIID subunit 10b OS=Drosophila melanogaster OX=7227 GN=Taf10b PE=1 SV=1
4	Q9U5W9	2.73e-41	140	167	0.317	0.413	TAF10_DROME Transcription initiation factor TFIID subunit 10 OS=Drosophila melanogaster OX=7227 GN=Taf10 PE=1 SV=2
5	O04173	1.38e-32	116	134	0.243	0.396	TAF10_ARATH Transcription initiation factor TFIID subunit 10 OS=Arabidopsis thaliana OX=3702 GN=TAF10 PE=1 SV=1
6	O60171	1.53e-26	103	215	0.239	0.242	TAF10_SCHPO Transcription initiation factor TFIID subunit 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf10 PE=3 SV=1
7	Q21172	2.20e-26	102	176	0.239	0.295	Q21172_CAEEL Transcription initiation factor TFIID subunit 10 OS=Caenorhabditis elegans OX=6239 GN=taf-10 PE=1 SV=1
8	Q95ZS0	3.41e-26	101	179	0.239	0.291	TAF10_CAEEL Transcription initiation factor TFIID subunit 10 OS=Caenorhabditis elegans OX=6239 GN=taf-10 PE=1 SV=1
9	Q12030	2.63e-18	81.6	206	0.193	0.204	TAF10_YEAST Transcription initiation factor TFIID subunit 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF10 PE=1 SV=1
10	Q5BH26	4.45e-12	65.9	268	0.142	0.116	Q5BH26_EMENI Transcription initiation factor TFIID subunit 10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00154 PE=3 SV=1
11	Q9U1H9	0.006	39.7	672	0.115	0.037	NXF1_DROME Nuclear RNA export factor 1 OS=Drosophila melanogaster OX=7227 GN=sbr PE=1 SV=2
12	O75962	0.16	35.4	3097	0.174	0.012	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
13	A8K940	0.27	34.7	1059	0.128	0.026	A8K940_HUMAN cDNA FLJ77630, highly similar to Homo sapiens BPY2 interacting protein 1, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
14	Q66K74	0.27	34.7	1059	0.128	0.026	MAP1S_HUMAN Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2
15	Q96EP1	0.42	33.9	664	0.078	0.026	CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR PE=1 SV=2
16	Q988B7	7.2	29.6	248	0.138	0.121	PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=pldh-t PE=1 SV=1
17	Q2LDA1	9.7	29.6	1491	0.106	0.015	Q2LDA1_DANRE Collagen alpha-1(II) chain precursor OS=Danio rerio OX=7955 GN=col2a1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07524 Bromo_TP	5.5	18.4	Bromodomain associated
2	PF03540 TFIID_30kDa	3.2e-23	92.7	Transcription initiation factor TFIID 23-30kDa subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299424

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000307684	0.999	Transcriptional adapter 3
4	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000340271	0.999	Transcription initiation factor TFIID subunit 3
6	9606.ENSP00000352925	0.999	Transformation/transcription domain-associated protein
7	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
8	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
9	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
10	9606.ENSP00000360515	0.999	Transcription initiation protein SPT3 homolog
11	9606.ENSP00000362068	0.999	Transcription initiation factor TFIID subunit 8
12	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
13	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
14	9606.ENSP00000375942	0.999	TATA-box-binding protein
15	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
16	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
17	9606.ENSP00000397259	0.998	Ataxin-7-like protein 3
18	9606.ENSP00000225916	0.997	Histone acetyltransferase KAT2A
19	9606.ENSP00000263754	0.997	Histone acetyltransferase KAT2B
20	9606.ENSP00000294168	0.997	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016251	0.999	RNA polymerase II general transcription initiation factor activity
GO:0003824	0.992	catalytic activity
GO:0016740	0.978	transferase activity
GO:0008134	0.976	transcription factor binding
GO:0140297	0.951	DNA-binding transcription factor binding
GO:0140096	0.950	catalytic activity, acting on a protein
GO:0016410	0.938	N-acyltransferase activity
GO:0061629	0.935	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016407	0.931	acetyltransferase activity
GO:0070063	0.925	RNA polymerase binding
GO:0004402	0.920	histone acetyltransferase activity
GO:0042802	0.919	identical protein binding
GO:0030331	0.916	nuclear estrogen receptor binding
GO:0097159	0.891	organic cyclic compound binding
GO:1901363	0.879	heterocyclic compound binding
GO:0003676	0.797	nucleic acid binding
GO:0003682	0.714	chromatin binding
GO:0003677	0.710	DNA binding
GO:1990841	0.655	promoter-specific chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0006352	0.990	DNA-templated transcription initiation
GO:0050794	0.986	regulation of cellular process
GO:0080090	0.979	regulation of primary metabolic process
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0016570	0.979	histone modification
GO:0065004	0.978	protein-DNA complex assembly
GO:0018205	0.977	peptidyl-lysine modification
GO:0006367	0.977	transcription initiation at RNA polymerase II promoter
GO:0019219	0.972	regulation of nucleobase-containing compound metabolic process
GO:0070897	0.969	transcription preinitiation complex assembly
GO:0048518	0.967	positive regulation of biological process
GO:0051252	0.964	regulation of RNA metabolic process
GO:0051123	0.962	RNA polymerase II preinitiation complex assembly
GO:0045944	0.946	positive regulation of transcription by RNA polymerase II
GO:0016573	0.926	histone acetylation
GO:2000142	0.892	regulation of DNA-templated transcription initiation
GO:0043966	0.873	histone H3 acetylation
GO:0070647	0.857	protein modification by small protein conjugation or removal
GO:0016071	0.848	mRNA metabolic process
GO:0070646	0.842	protein modification by small protein removal
GO:0042789	0.842	mRNA transcription by RNA polymerase II
GO:0060260	0.832	regulation of transcription initiation by RNA polymerase II
GO:0060261	0.797	positive regulation of transcription initiation by RNA polymerase II
GO:0006793	0.682	phosphorus metabolic process
GO:0016579	0.594	protein deubiquitination
GO:0016578	0.549	histone deubiquitination
GO:0006796	0.450	phosphate-containing compound metabolic process
GO:0016310	0.349	phosphorylation
GO:0006468	0.328	protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005669	1.000	transcription factor TFIID complex
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005737	0.984	cytoplasm
GO:0000785	0.981	chromatin
GO:0070461	0.948	SAGA-type complex
GO:1905368	0.671	peptidase complex
GO:0000124	0.659	SAGA complex
GO:0033276	0.372	transcription factor TFTC complex
GO:0048471	0.333	perinuclear region of cytoplasm
GO:0032993	0.318	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.978	Transferases.
EC:2.3.1.-	0.938	Transferring groups other than amino-acyl groups.
RHEA:21992	0.920	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.920	histone acetyltransferase.

[back to server]