StarFunc result for job id Q12965

User Input

>input (1108 residues)
MGSKGVYQYHWQSHNVKHSGVDDMVLLSKITENSIVENLKKRYMDDYIFTYIGSVLISVN
PFKQMPYFGEKEIEMYQGAAQYENPPHIYALADNMYRNMIIDRENQCVIISGESGAGKTV
AAKYIMSYISRVSGGGTKVQHVKDIILQSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSP
GGEPDGGKISNFLLEKSRVVMRNPGERSFHIFYQLIEGASAEQKHSLGITSMDYYYYLSL
SGSYKVDDIDDRREFQETLHAMNVIGIFAEEQTLVLQIVAGILHLGNISFKEVGNYAAVE
SEEFLAFPAYLLGINQDRLKEKLTSRQMDSKWGGKSESIHVTLNVEQACYTRDALAKALH
ARVFDFLVDSINKAMEKDHEEYNIGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELT
LKAEQEEYVQEGIRWTPIEYFNNKIVCDLIENKVNPPGIMSILDDVCATMHAVGEGADQT
LLQKLQMQIGSHEHFNSWNQGFIIHHYAGKVSYDMDGFCERNRDVLFMDLIELMQSSELP
FIKSLFPENLQADKKGRPTTAGSKIKKQANDLVSTLMKCTPHYIRCIKPNETKKPRDWEE
SRVKHQVEYLGLKENIRVRRAGYAYRRIFQKFLQRYAILTKATWPSWQGEEKQGVLHLLQ
SVNMDSDQFQLGRSKVFIKAPESLFLLEEMRERKYDGYARVIQKSWRKFVARKKYVQMRE
EASDLLLNKKERRRNSINRNFIGDYIGMEEHPELQQFVGKREKIDFADTVTKYDRRFKGV
KRDLLLTPKCLYLIGREKVKQGPDKGLVKEVLKRKIEIERILSVSLSTMQDDIFILHEQE
YDSLLESVFKTEFLSLLAKRYEEKTQKQLPLKFSNTLELKLKKENWGPWSAGGSRQVQFH
QGFGDLAVLKPSNKVLQVSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPG
YHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPESLDFLKV
PDQGAAGVRRQTTSRPPPAGGRPKPQPKPKPQVPQCKALYAYDAQDTDELSFNANDIIDI
IKEDPSGWWTGRLRGKQGLFPNNYVTKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FDV0	0.701	0.696	0.000	1117	0.816	0.809	E7FDV0.pdb.gz	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
2	AFDB:F1NNT7	0.832	0.839	0.000	1099	0.729	0.735	F1NNT7.pdb.gz
3	AFDB:F1QJK0	0.595	0.602	0.000	1096	0.754	0.762	F1QJK0.pdb.gz
4	AFDB:P34092	0.548	0.546	0.000	1111	0.463	0.462	P34092.pdb.gz	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2
5	AFDB:P70248	0.685	0.690	0.000	1099	0.710	0.716	P70248.pdb.gz	MYO1F_MOUSE Unconventional myosin-If OS=Mus musculus OX=10090 GN=Myo1f PE=1 SV=1
6	AFDB:Q12965	1.000	1.000	0.000	1108	1.000	1.000	Q12965.pdb.gz	MYO1E_HUMAN Unconventional myosin-Ie OS=Homo sapiens OX=9606 GN=MYO1E PE=1 SV=2
7	AFDB:Q04439	0.549	0.501	1.926E-101	1219	0.411	0.373	Q04439.pdb.gz	MYO5_YEAST Myosin-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO5 PE=1 SV=1
8	AFDB:Q2US45	0.549	0.485	4.207E-100	1261	0.396	0.348	Q2US45.pdb.gz	MYO1_ASPOR Myosin-1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=myoA PE=3 SV=1
9	AFDB:P36006	0.545	0.477	4.851E-100	1272	0.400	0.348	P36006.pdb.gz	MYO3_YEAST Myosin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO3 PE=1 SV=4
10	AFDB:Q00647	0.561	0.500	5.864E-100	1249	0.412	0.366	Q00647.pdb.gz	MYO1_EMENI Myosin-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=myoA PE=1 SV=2
11	PDB:4anjA	0.537	0.596	3.361E-58	995	0.240	0.267	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:4pa0A	0.489	0.552	5.134E-56	974	0.252	0.286	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.491	0.586	5.900E-54	920	0.248	0.299	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.564	0.755	1.288E-52	817	0.194	0.263	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.494	0.571	6.166E-52	952	0.245	0.285	4p7hB.pdb.gz
16	PDB:7mf3B	0.568	0.695	1.576E-45	896	0.236	0.292	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.544	0.624	8.668E-43	954	0.246	0.286	5tbyA.pdb.gz
18	PDB:4mk0A	0.082	0.137	5.963E-4	631	0.017	0.030	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:2lqnA	0.051	0.179	1.005E-3	303	0.022	0.079	2lqnA.pdb.gz
20	PDB:4mt6A	0.074	0.190	1.158E-3	389	0.043	0.123	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286Y9H2	636	1069	0.301	0.312	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	A0A2R8Q9G7	635	1068	0.301	0.312	A0A2R8Q9G7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=fj81f11 PE=1 SV=1
3	A5PF48	600	1026	0.297	0.321	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
4	B0I1S9	637	1136	0.302	0.295	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
5	E7F5R7	636	1043	0.301	0.319	E7F5R7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1c PE=1 SV=3
6	E7F9L8	569	1004	0.279	0.308	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
7	E7FDV0	1883	1117	0.820	0.814	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
8	E9PDF6	636	1107	0.302	0.303	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
9	E9Q634	2192	1107	0.961	0.962	MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1
10	F1PRN2	577	1006	0.278	0.306	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
11	F5H6E2	625	1039	0.299	0.319	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
12	O00159	625	1063	0.299	0.311	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
13	O00160	1634	1098	0.713	0.719	MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens OX=9606 GN=MYO1F PE=1 SV=3
14	O43795	637	1136	0.302	0.295	MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3
15	O88329	611	1043	0.298	0.316	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
16	O94832	578	1006	0.279	0.307	MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2
17	P22467	741	994	0.369	0.411	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
18	P34092	925	1111	0.464	0.463	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2
19	P34109	816	1109	0.406	0.406	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
20	P36006	741	1272	0.360	0.314	MYO3_YEAST Myosin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	15	17.4	AAA ATPase domain
2	PF13401 AAA_22	1.5e+02	14.1	AAA domain
3	PF00612 IQ	96	14.2	IQ calmodulin-binding motif
4	PF16796 Microtub_bd	2.4e+02	13.0	Microtubule binding
5	PF00063 Myosin_head	6e-249	839.5	Myosin head (motor domain)
6	PF06017 Myosin_TH1	1.1e-51	186.8	Unconventional myosin tail, actin- and lipid-binding
7	PF00018 SH3_1	1.8e-13	61.2	SH3 domain
8	PF07653 SH3_2	5.8e-08	43.7	Variant SH3 domain
9	PF14604 SH3_9	4.8e-12	56.9	Variant SH3 domain
10	PF00158 Sigma54_activat	2.6e+02	12.7	Sigma-54 interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288235

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005257	0.909	Ras-related protein Ral-A
2	9606.ENSP00000458162	0.884	Actin, cytoplasmic 2
3	9606.ENSP00000349960	0.878	Actin, cytoplasmic 1
4	9606.ENSP00000365891	0.878	Wiskott-Aldrich syndrome protein
5	9606.ENSP00000223023	0.873	Neural Wiskott-Aldrich syndrome protein
6	9606.ENSP00000367220	0.842	Actin-related protein 2
7	9606.ENSP00000349467	0.837	Calmodulin-1
8	9606.ENSP00000282032	0.758	ARL14 effector protein
9	9606.ENSP00000263071	0.746	Scavenger receptor class F member 1
10	9606.ENSP00000316809	0.744	Phosphatidylinositol transfer protein alpha isoform
11	9606.ENSP00000376330	0.741	WAS/WASL-interacting protein family member 1
12	9606.ENSP00000291295	0.731	Calmodulin 3 (phosphorylase kinase, delta)
13	9606.ENSP00000350052	0.723	POTE ankyrin domain family member F
14	9606.ENSP00000272298	0.717	Calmodulin 2 (phosphorylase kinase, delta)
15	9606.ENSP00000228825	0.716	Actin-related protein 2/3 complex subunit 3
16	9606.ENSP00000380378	0.716	Platelet-activating factor acetylhydrolase IB subunit alpha
17	9606.ENSP00000376410	0.699	Inverted formin-2
18	9606.ENSP00000388169	0.689	Actin-related protein 2/3 complex subunit 4
19	9606.ENSP00000296782	0.688	Rapamycin-insensitive companion of mTOR
20	9606.ENSP00000264335	0.685	14-3-3 protein epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	0.998	actin binding
GO:0140657	0.997	ATP-dependent activity
GO:0044877	0.997	protein-containing complex binding
GO:0003774	0.986	cytoskeletal motor activity
GO:0000146	0.983	microfilament motor activity
GO:0035091	0.890	phosphatidylinositol binding
GO:0051015	0.877	actin filament binding
GO:0005516	0.836	calmodulin binding
GO:0003824	0.444	catalytic activity
GO:0043168	0.367	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.959	multicellular organismal process
GO:0032502	0.936	developmental process
GO:0048856	0.928	anatomical structure development
GO:0009987	0.881	cellular process
GO:0051179	0.589	localization
GO:0050789	0.547	regulation of biological process
GO:0050794	0.508	regulation of cellular process
GO:0007275	0.472	multicellular organism development
GO:0097205	0.470	renal filtration
GO:0048731	0.373	system development
GO:0071840	0.367	cellular component organization or biogenesis
GO:0016043	0.363	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.997	cell periphery
GO:0016020	0.997	membrane
GO:0015629	0.997	actin cytoskeleton
GO:0043227	0.996	membrane-bounded organelle
GO:0005829	0.995	cytosol
GO:0032991	0.988	protein-containing complex
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0005576	0.983	extracellular region
GO:0005886	0.981	plasma membrane
GO:0070062	0.951	extracellular exosome
GO:0042995	0.945	cell projection
GO:0030054	0.869	cell junction
GO:0005938	0.825	cell cortex
GO:0070161	0.787	anchoring junction
GO:0120025	0.696	plasma membrane bounded cell projection
GO:0030864	0.578	cortical actin cytoskeleton
GO:0031410	0.570	cytoplasmic vesicle
GO:0012505	0.507	endomembrane system
GO:0099081	0.401	supramolecular polymer
GO:0098590	0.394	plasma membrane region
GO:0031252	0.361	cell leading edge
GO:0031253	0.361	cell projection membrane
GO:0098858	0.349	actin-based cell projection
GO:0005634	0.347	nucleus
GO:0016459	0.339	myosin complex
GO:0005911	0.332	cell-cell junction
GO:0098862	0.330	cluster of actin-based cell projections
GO:0005902	0.327	microvillus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.983	myosin ATPase.

[back to server]