StarFunc result for job id Q12968

User Input

>input (1075 residues)
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPL
CLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQELDAHEDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSD
DQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCRDESVSKEQHM
IPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVAD
QITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDRE
PNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JTY4	0.409	0.408	0.000	1076	0.894	0.893	A0A0G2JTY4.pdb.gz	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
2	AFDB:B5B2S1	0.273	0.273	0.000	1075	1.000	1.000	B5B2S1.pdb.gz	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
3	AFDB:Q14934	0.312	0.363	9.973E-59	902	0.379	0.451	Q14934.pdb.gz	NFAC4_HUMAN Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4 PE=1 SV=2
4	AFDB:O95644	0.226	0.253	8.487E-55	943	0.369	0.421	O95644.pdb.gz	NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3
5	AFDB:A0A1D5PNG2	0.234	0.277	2.302E-53	890	0.355	0.429	A0A1D5PNG2.pdb.gz
6	PDB:5c6wJ	0.074	0.263	1.942E-4	238	0.028	0.126	5c6wJ.pdb.gz
7	AFDB:A1Z8J4	0.064	0.053	2.003E-4	1557	0.146	0.101	A1Z8J4.pdb.gz	A1Z8J4_DROME No mechanoreceptor potential A, isoform A OS=Drosophila melanogaster OX=7227 GN=nompA PE=4 SV=1
8	AFDB:Q383H0	0.039	0.033	2.479E-4	1439	0.159	0.119	Q383H0.pdb.gz	Q383H0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2880 PE=4 SV=1
9	PDB:7tvzE	0.123	0.183	3.307E-4	665	0.034	0.056	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
10	PDB:3o3uN	0.078	0.125	4.092E-4	580	0.027	0.050	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
11	AFDB:Q54NE5	0.094	0.066	4.695E-4	1918	0.102	0.057	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
12	PDB:1f13A	0.108	0.146	1.125E-3	722	0.028	0.042	1f13A.pdb.gz
13	AFDB:Q15735	0.095	0.099	1.224E-3	1006	0.127	0.136	Q15735.pdb.gz	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
14	PDB:5mhlA	0.103	0.143	1.251E-3	692	0.027	0.042	5mhlA.pdb.gz	Structure of active coagulation factor XIII triggered by calcium binding: basis for the design of next-generation anticoagulants.
15	PDB:3fcsA	0.103	0.119	1.633E-3	913	0.030	0.035	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
16	PDB:4nehA	0.101	0.101	2.637E-3	1084	0.032	0.031	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
17	PDB:4pfeA	0.079	0.205	3.629E-3	342	0.023	0.073	4pfeA.pdb.gz
18	PDB:2qhrL	0.084	0.261	4.257E-3	218	0.020	0.096	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
19	PDB:7nxdA	0.106	0.120	4.257E-3	905	0.034	0.041	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
20	AFDB:B2RY69	0.084	0.075	5.151E-3	1237	0.074	0.065	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTY4	0.0	1830	1076	0.894	0.893	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
2	A0A8I6AB55	0.0	1781	1052	0.869	0.888	A0A8I6AB55_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
3	B5B2S0	0.0	2100	1068	0.963	0.969	B5B2S0_HUMAN Nuclear factor of activated T-cells c3 isoform IB-Xa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
4	B5B2S1	0.0	2177	1075	1.000	1.000	B5B2S1_HUMAN Nuclear factor of activated T-cells c3 isoform IB-deltaXa OS=Homo sapiens OX=9606 GN=NFATC3 PE=2 SV=1
5	D3ZU59	0.0	1778	1068	0.869	0.875	D3ZU59_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
6	H3BR83	0.0	2030	1053	0.932	0.952	H3BR83_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
7	H3BRS1	0.0	2108	1060	0.969	0.983	H3BRS1_HUMAN Nuclear factor of activated T cells 3 (Fragment) OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
8	I3L3K7	0.0	2102	1047	0.963	0.989	I3L3K7_HUMAN Nuclear factor of activated T cells 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
9	P97305	0.0	1850	1075	0.905	0.905	NFAC3_MOUSE Nuclear factor of activated T-cells, cytoplasmic 3 OS=Mus musculus OX=10090 GN=Nfatc3 PE=1 SV=1
10	Q12968	0.0	2177	1075	1.000	1.000	NFAC3_HUMAN Nuclear factor of activated T-cells, cytoplasmic 3 OS=Homo sapiens OX=9606 GN=NFATC3 PE=1 SV=1
11	A0A1D5PI24	1.21e-179	544	732	0.301	0.443	A0A1D5PI24_CHICK Nuclear factor of activated T cells 1 OS=Gallus gallus OX=9031 GN=NFATC1 PE=4 SV=2
12	O88942	5.77e-176	534	717	0.313	0.470	NFAC1_MOUSE Nuclear factor of activated T-cells, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Nfatc1 PE=1 SV=1
13	Q14934	2.13e-173	533	902	0.328	0.391	NFAC4_HUMAN Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4 PE=1 SV=2
14	A0A0G2JXL2	2.71e-173	534	925	0.296	0.344	A0A0G2JXL2_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=2
15	D3ZE20	5.24e-173	533	939	0.296	0.339	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
16	D3Z9H7	6.84e-172	530	901	0.296	0.353	NFAC4_RAT Nuclear factor of activated T-cells, cytoplasmic 4 OS=Rattus norvegicus OX=10116 GN=Nfatc4 PE=1 SV=1
17	Q8K120	1.06e-170	526	901	0.293	0.350	NFAC4_MOUSE Nuclear factor of activated T-cells, cytoplasmic 4 OS=Mus musculus OX=10090 GN=Nfatc4 PE=1 SV=2
18	O95644	3.14e-170	526	943	0.290	0.331	NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3
19	Q19AW4	3.33e-169	521	867	0.273	0.339	Q19AW4_DANRE Nuclear factor of activated T-cells calcineurin-dependent 1 OS=Danio rerio OX=7955 GN=si:ch211-198c22.2 PE=2 SV=1
20	W5U9R6	1.60e-147	465	879	0.243	0.297	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16179 RHD_dimer	2.1e-22	90.5	Rel homology dimerisation domain
2	PF00554 RHD_DNA_bind	3.5e-20	84.1	Rel homology DNA-binding domain
3	PF01833 TIG	0.16	23.4	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300659

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378974	0.978	Mitogen-activated protein kinase 8
2	9606.ENSP00000394560	0.967	Mitogen-activated protein kinase 9
3	9606.ENSP00000421689	0.958	Casein kinase I isoform alpha
4	9606.ENSP00000360266	0.955	Transcription factor AP-1
5	9606.ENSP00000234310	0.951	Calcineurin subunit B type 1
6	9606.ENSP00000306245	0.949	Proto-oncogene c-Fos
7	9606.ENSP00000239938	0.923	Early growth response protein 1
8	9606.ENSP00000310170	0.923	Fos-related antigen 1
9	9606.ENSP00000370343	0.920	Interferon regulatory factor 4
10	9606.ENSP00000379330	0.920	Nuclear factor of activated T-cells, cytoplasmic 2
11	9606.ENSP00000382423	0.920	Mitogen-activated protein kinase kinase kinase 1
12	9606.ENSP00000287820	0.916	Peroxisome proliferator-activated receptor gamma
13	9606.ENSP00000303315	0.915	Transcription factor jun-B
14	9606.ENSP00000327048	0.914	Transcription factor Maf
15	9606.ENSP00000334458	0.914	Transcription factor GATA-4
16	9606.ENSP00000389377	0.914	Nuclear factor of activated T-cells, cytoplasmic 1
17	9606.ENSP00000367830	0.911	Protein kinase C zeta type
18	9606.ENSP00000383003	0.911	Peptidyl-prolyl cis-trans isomerase FKBP1A
19	9606.ENSP00000265372	0.910	cAMP responsive element modulator
20	9606.ENSP00000378306	0.909	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0001217	0.995	DNA-binding transcription repressor activity
GO:0001227	0.992	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.943	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.849	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019899	0.627	enzyme binding
GO:0033218	0.341	amide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.995	positive regulation of cellular process
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0010604	0.992	positive regulation of macromolecule metabolic process
GO:0051173	0.990	positive regulation of nitrogen compound metabolic process
GO:0031325	0.980	positive regulation of cellular metabolic process
GO:0031328	0.939	positive regulation of cellular biosynthetic process
GO:0045893	0.931	positive regulation of DNA-templated transcription
GO:0050896	0.844	response to stimulus
GO:0009987	0.813	cellular process
GO:0051716	0.654	cellular response to stimulus
GO:0007154	0.502	cell communication
GO:0023052	0.490	signaling
GO:0007165	0.426	signal transduction
GO:0032501	0.406	multicellular organismal process
GO:0006357	0.406	regulation of transcription by RNA polymerase II
GO:0008152	0.402	metabolic process
GO:0032502	0.396	developmental process
GO:0071704	0.394	organic substance metabolic process
GO:0048856	0.392	anatomical structure development
GO:0048519	0.389	negative regulation of biological process
GO:0045944	0.379	positive regulation of transcription by RNA polymerase II
GO:0048523	0.372	negative regulation of cellular process
GO:0006950	0.346	response to stress
GO:0042221	0.337	response to chemical
GO:0044237	0.322	cellular metabolic process
GO:0006807	0.301	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.492	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]