StarFunc result for job id Q12972

User Input

>input (351 residues)
MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDF
TIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGAS
TRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTL
TIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEG
PGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPD
VDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1WC70	0.791	0.791	4.090E-56	351	0.977	0.977	B1WC70.pdb.gz
2	AFDB:Q9V7W9	0.455	0.420	5.722E-30	383	0.484	0.444	Q9V7W9.pdb.gz	Q9V7W9_DROME Nuclear inhibitor of protein phosphatase 1 OS=Drosophila melanogaster OX=7227 GN=NiPp1 PE=1 SV=1
3	AFDB:Q55EZ0	0.349	0.453	2.693E-15	268	0.131	0.172	Q55EZ0.pdb.gz	Q55EZ0_DICDI Peptidyl-prolyl cis-trans isomerase OS=Dictyostelium discoideum OX=44689 GN=pinA PE=4 SV=1
4	PDB:7dvqX	0.317	0.698	6.542E-12	156	0.108	0.244	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
5	PDB:5gm6U	0.306	0.591	3.090E-7	176	0.051	0.102	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
6	AFDB:Q9Z7J3	0.269	0.115	6.010E-7	845	0.137	0.057	Q9Z7J3.pdb.gz	Q9Z7J3_CHLPN Adenylate cyclase-like protein OS=Chlamydia pneumoniae OX=83558 GN=CP_0034 PE=1 SV=1
7	PDB:2ff4A	0.243	0.226	1.462E-6	379	0.051	0.047	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
8	PDB:5z56X	0.273	0.586	5.818E-6	159	0.063	0.138	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
9	AFDB:Q9M8A0	0.278	0.171	1.345E-5	585	0.145	0.087	Q9M8A0.pdb.gz	Q9M8A0_ARATH F16B3.3 protein OS=Arabidopsis thaliana OX=3702 GN=FHA3 PE=1 SV=1
10	PDB:2kb3A	0.247	0.563	2.598E-5	143	0.068	0.168	2kb3A.pdb.gz
11	PDB:6l9wD	0.210	0.491	4.117E-5	142	0.040	0.099	6l9wD.pdb.gz
12	AFDB:Q9D842	0.239	0.171	1.899E-4	499	0.134	0.094	Q9D842.pdb.gz	APLF_MOUSE Aprataxin and PNK-like factor OS=Mus musculus OX=10090 GN=Aplf PE=1 SV=2
13	AFDB:Q8IW19	0.230	0.162	3.188E-4	511	0.142	0.098	Q8IW19.pdb.gz	APLF_HUMAN Aprataxin and PNK-like factor OS=Homo sapiens OX=9606 GN=APLF PE=1 SV=1
14	PDB:2kfuA	0.244	0.486	5.813E-4	162	0.091	0.198	2kfuA.pdb.gz
15	PDB:7wrgA	0.240	0.109	1.378E-3	812	0.043	0.018	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
16	PDB:7wrgB	0.233	0.109	2.184E-3	783	0.043	0.019	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
17	AFDB:O60934	0.243	0.122	5.347E-2	754	0.151	0.070	O60934.pdb.gz	NBN_HUMAN Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1
18	AFDB:Q03306	0.092	0.047	1.507E-1	898	0.142	0.056	Q03306.pdb.gz	PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PKH3 PE=1 SV=1
19	PDB:6u426U	0.094	0.067	1.837E-1	569	0.054	0.033	6u426U.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
20	AFDB:Q6NYV7	0.103	0.044	4.009E-1	1001	0.123	0.043	Q6NYV7.pdb.gz	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12972	0.0	721	351	1.000	1.000	PP1R8_HUMAN Nuclear inhibitor of protein phosphatase 1 OS=Homo sapiens OX=9606 GN=PPP1R8 PE=1 SV=2
2	Q8R3G1	0.0	709	351	0.980	0.980	PP1R8_MOUSE Nuclear inhibitor of protein phosphatase 1 OS=Mus musculus OX=10090 GN=Ppp1r8 PE=1 SV=1
3	A0A0A0MT09	4.45e-148	417	205	0.584	1.000	A0A0A0MT09_HUMAN Protein phosphatase 1 regulatory subunit 8 (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R8 PE=1 SV=1
4	Q9V7W9	4.26e-97	295	383	0.504	0.462	Q9V7W9_DROME Nuclear inhibitor of protein phosphatase 1 OS=Drosophila melanogaster OX=7227 GN=NiPp1 PE=1 SV=1
5	Q6ICT4	1.43e-86	258	127	0.362	1.000	Q6ICT4_HUMAN PPP1R8 protein (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R8 PE=2 SV=1
6	Q9FIK2	1.02e-23	102	369	0.142	0.136	PP1R8_ARATH Protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog OS=Arabidopsis thaliana OX=3702 GN=At5g47790 PE=1 SV=1
7	Q55EZ0	3.36e-21	93.6	268	0.128	0.168	Q55EZ0_DICDI Peptidyl-prolyl cis-trans isomerase OS=Dictyostelium discoideum OX=44689 GN=pinA PE=4 SV=1
8	Q57XM6	6.07e-19	89.0	383	0.219	0.201	Q57XM6_TRYB2 Peptidyl-prolyl cis-trans isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.530 PE=1 SV=1
9	Q8W4D8	7.34e-13	70.5	314	0.120	0.134	DDL_ARATH FHA domain-containing protein DDL OS=Arabidopsis thaliana OX=3702 GN=DDL PE=1 SV=1
10	E9Q585	3.75e-11	66.6	715	0.111	0.055	E9Q585_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
11	E9PX68	4.33e-11	66.6	744	0.111	0.052	E9PX68_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
12	B1AK66	4.57e-11	65.9	396	0.114	0.101	B1AK66_HUMAN Smad nuclear interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=2 SV=1
13	Q8TAD8	4.57e-11	65.9	396	0.114	0.101	SNIP1_HUMAN Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1
14	Q8BIZ6	5.06e-11	65.5	383	0.111	0.102	SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus OX=10090 GN=Snip1 PE=1 SV=1
15	E9Q1Q0	5.40e-11	65.9	534	0.111	0.073	E9Q1Q0_MOUSE Solute carrier family 4 (anion exchanger), member 1, adaptor protein OS=Mus musculus OX=10090 GN=Slc4a1ap PE=1 SV=1
16	Q9BWU0	5.46e-11	66.2	796	0.114	0.050	NADAP_HUMAN Kanadaptin OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
17	Q6GQW1	5.67e-11	65.9	537	0.111	0.073	Q6GQW1_MOUSE Slc4a1ap protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
18	A0A087X0M4	6.19e-11	65.9	742	0.114	0.054	A0A087X0M4_HUMAN Solute carrier family 4 member 1 adaptor protein OS=Homo sapiens OX=9606 GN=SLC4A1AP PE=1 SV=1
19	Q3UUI2	6.48e-11	65.9	536	0.111	0.073	Q3UUI2_MOUSE FHA domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Slc4a1ap PE=2 SV=1
20	Q4V8W8	6.24e-10	62.4	374	0.111	0.104	Q4V8W8_DANRE Smad nuclear-interacting protein OS=Danio rerio OX=7955 GN=snip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	5.4e-13	60.4	FHA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000001362

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000008082	0.977	Protein phosphatase 1, catalytic subunit, alpha isozyme
2	132908.ENSPVAP00000012039	0.976	annotation not available
3	132908.ENSPVAP00000011671	0.974	Casein kinase 2, beta polypeptide
4	132908.ENSPVAP00000000468	0.946	Protein kinase, cAMP-dependent, catalytic, beta
5	132908.ENSPVAP00000016560	0.946	Protein kinase, cAMP-dependent, catalytic, alpha
6	132908.ENSPVAP00000003326	0.892	Protein phosphatase 1, catalytic subunit, gamma isozyme
7	132908.ENSPVAP00000005095	0.846	Polyribonucleotide nucleotidyltransferase 1
8	132908.ENSPVAP00000004373	0.787	Casein kinase 2, alpha prime polypeptide
9	132908.ENSPVAP00000013058	0.759	Protein phosphatase 1, catalytic subunit, beta isozyme
10	132908.ENSPVAP00000007842	0.745	Splicing factor 3b, subunit 1, 155kDa
11	132908.ENSPVAP00000003765	0.698	Protein phosphatase 1, regulatory subunit 10
12	132908.ENSPVAP00000004334	0.695	Cell division cycle 5-like
13	132908.ENSPVAP00000012539	0.693	Protein phosphatase 1, regulatory subunit 3B
14	132908.ENSPVAP00000000520	0.674	Protein phosphatase 1, regulatory subunit 7
15	132908.ENSPVAP00000005835	0.665	Zinc finger protein 622
16	132908.ENSPVAP00000004165	0.656	Protein kinase, X-linked
17	132908.ENSPVAP00000007867	0.620	Protein phosphatase 1, regulatory (inhibitor) subunit 11
18	132908.ENSPVAP00000007107	0.596	Embryonic ectoderm development
19	132908.ENSPVAP00000016808	0.587	Transmembrane protein 209
20	132908.ENSPVAP00000000785	0.577	N-acetylneuraminate pyruvate lyase (dihydrodipicolinate synthase)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030234	0.998	enzyme regulator activity
GO:0019208	0.901	phosphatase regulator activity
GO:0019888	0.887	protein phosphatase regulator activity
GO:0097159	0.517	organic cyclic compound binding
GO:1901363	0.515	heterocyclic compound binding
GO:0003676	0.483	nucleic acid binding
GO:0003824	0.412	catalytic activity
GO:0003723	0.389	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.929	organic substance metabolic process
GO:0044237	0.925	cellular metabolic process
GO:0044238	0.916	primary metabolic process
GO:0006807	0.909	nitrogen compound metabolic process
GO:0043170	0.897	macromolecule metabolic process
GO:0065007	0.607	biological regulation
GO:0006725	0.599	cellular aromatic compound metabolic process
GO:0046483	0.596	heterocycle metabolic process
GO:1901360	0.585	organic cyclic compound metabolic process
GO:0050789	0.565	regulation of biological process
GO:0034641	0.537	cellular nitrogen compound metabolic process
GO:0090304	0.532	nucleic acid metabolic process
GO:0016070	0.430	RNA metabolic process
GO:0050794	0.368	regulation of cellular process
GO:0019222	0.321	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	0.999	nuclear speck
GO:0005829	0.427	cytosol
GO:0032991	0.341	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]