StarFunc result for job id Q12979

User Input

>input (859 residues)
MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQL
SARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPL
KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ
LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPI
DRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR
QLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSP
EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL
NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCF
KLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKT
RVFRDTAEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDP
QTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKV
PYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGT
LKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLK
RVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH
PPISFAELKRNTLYFSTDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JTR4	0.781	0.781	0.000	859	0.984	0.984	A0A0G2JTR4.pdb.gz	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2
2	AFDB:P11274	0.739	0.523	1.023E-92	1271	0.662	0.448	P11274.pdb.gz	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
3	AFDB:X2JC00	0.354	0.232	7.145E-58	1404	0.324	0.198	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
4	AFDB:O96833	0.281	0.359	2.064E-44	658	0.284	0.371	O96833.pdb.gz	O96833_DROME EG:23E12.2 protein OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
5	AFDB:Q96PE2	0.206	0.095	7.426E-20	2063	0.140	0.058	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
6	AFDB:Q9V9S7	0.341	0.162	1.247E-19	1866	0.130	0.060	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
7	AFDB:Q5VT97	0.334	0.246	4.764E-19	1194	0.123	0.089	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2
8	AFDB:Q86NH1	0.343	0.300	1.181E-18	987	0.101	0.088	Q86NH1.pdb.gz	SYD1_CAEEL Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans OX=6239 GN=syd-1 PE=2 SV=1
9	AFDB:Q21653	0.204	0.149	6.950E-18	1182	0.139	0.101	Q21653.pdb.gz	OSG1_CAEEL Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans OX=6239 GN=osg-1 PE=2 SV=4
10	AFDB:Q6ZW31	0.207	0.240	2.654E-17	735	0.120	0.140	Q6ZW31.pdb.gz	SYDE1_HUMAN Rho GTPase-activating protein SYDE1 OS=Homo sapiens OX=9606 GN=SYDE1 PE=1 SV=1
11	PDB:7rx9A	0.214	0.392	3.908E-12	432	0.094	0.188	7rx9A.pdb.gz
12	PDB:4mt6A	0.269	0.539	9.999E-11	389	0.076	0.167	4mt6A.pdb.gz
13	PDB:3cxlA	0.208	0.434	1.413E-10	402	0.085	0.182	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
14	PDB:5c2kA	0.203	0.443	1.890E-9	382	0.080	0.181	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:1xa6A	0.203	0.428	3.176E-9	399	0.072	0.155	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
16	PDB:6r3vA	0.199	0.797	1.951E-8	198	0.056	0.242	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
17	PDB:5jcpA	0.180	0.407	2.196E-7	361	0.058	0.139	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
18	PDB:1cjyA	0.127	0.168	9.549E-7	633	0.061	0.082	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
19	PDB:4yknA	0.127	0.093	2.367E-6	1205	0.114	0.081	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
20	PDB:4gouA	0.215	0.329	5.154E-6	507	0.055	0.093	4gouA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTR4	0.0	1761	859	0.985	0.985	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2
2	F1LXF1	0.0	1144	1270	0.666	0.450	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
3	P11274	0.0	1142	1271	0.667	0.451	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
4	Q12979	0.0	1782	859	1.000	1.000	ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR PE=1 SV=2
5	Q5SSL4	0.0	1762	859	0.987	0.987	ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus OX=10090 GN=Abr PE=1 SV=1
6	Q6PAJ1	0.0	1144	1270	0.667	0.451	BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus OX=10090 GN=Bcr PE=1 SV=3
7	X2JC00	1.16e-134	437	1404	0.319	0.195	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
8	X2J9V9	1.22e-134	437	1402	0.319	0.195	X2J9V9_DROME Rho GTPase activating protein at 1A, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
9	Q29QE1	1.40e-134	437	1403	0.319	0.195	Q29QE1_DROME GH15984p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
10	Q8MSA6	5.28e-94	307	531	0.228	0.369	Q8MSA6_DROME LD45876p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=2 SV=1
11	C1C560	1.69e-82	286	903	0.205	0.195	C1C560_DROME MIP02960p OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
12	O96833	1.53e-79	272	658	0.194	0.254	O96833_DROME EG:23E12.2 protein OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
13	Q6W456	7.32e-56	197	317	0.135	0.366	Q6W456_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
14	Q6W453	8.77e-56	197	317	0.135	0.366	Q6W453_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
15	Q6W437	1.02e-55	197	317	0.135	0.366	Q6W437_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
16	Q6W434	6.01e-55	194	317	0.134	0.363	Q6W434_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
17	Q6W436	3.33e-54	192	317	0.133	0.360	Q6W436_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
18	Q6W435	4.55e-53	189	317	0.128	0.347	Q6W435_DROME RhoGAP1A (Fragment) OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=4 SV=1
19	Q9V9S7	4.08e-36	150	1866	0.133	0.061	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
20	Q6TLK4	1.00e-35	148	869	0.090	0.089	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	0.0025	29.4	C2 domain
2	PF00169 PH	3.7e-07	42.0	PH domain
3	PF15411 PH_10	1.1e+02	14.5	Pleckstrin homology domain
4	PF19057 PH_19	0.007	27.5	PH domain
5	PF00620 RhoGAP	1.6e-44	162.8	RhoGAP domain
6	PF00621 RhoGEF	2.9e-29	114.1	RhoGEF domain
7	PF15643 Tox-PL-2	2.5e+02	13.2	Papain fold toxin 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303909

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.957	Transforming protein RhoA
2	9606.ENSP00000348461	0.937	Ras-related C3 botulinum toxin substrate 1
3	9606.ENSP00000383118	0.791	Cell division control protein 42 homolog
4	9606.ENSP00000286827	0.647	T-lymphoma invasion and metastasis-inducing protein 1
5	9606.ENSP00000286424	0.637	Transmembrane BAX inhibitor motif containing 4
6	9606.ENSP00000471635	0.629	Uncharacterized protein
7	9606.ENSP00000307126	0.611	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
8	9606.ENSP00000382428	0.560	Disks large homolog 4
9	9606.ENSP00000369960	0.525	Alpha-1A adrenergic receptor
10	9606.ENSP00000352995	0.522	Rho guanine nucleotide exchange factor 18
11	9606.ENSP00000269321	0.520	Rho GDP-dissociation inhibitor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0140678	0.817	molecular function inhibitor activity
GO:0005085	0.796	guanyl-nucleotide exchange factor activity
GO:0019899	0.622	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.987	response to stimulus
GO:0048583	0.977	regulation of response to stimulus
GO:0023051	0.956	regulation of signaling
GO:0010646	0.956	regulation of cell communication
GO:0051716	0.919	cellular response to stimulus
GO:0051056	0.892	regulation of small GTPase mediated signal transduction
GO:0051345	0.838	positive regulation of hydrolase activity
GO:0071840	0.817	cellular component organization or biogenesis
GO:0016043	0.791	cellular component organization
GO:0035556	0.748	intracellular signal transduction
GO:0043087	0.705	regulation of GTPase activity
GO:0048518	0.592	positive regulation of biological process
GO:0007264	0.507	small GTPase mediated signal transduction
GO:0006996	0.506	organelle organization
GO:0032502	0.487	developmental process
GO:0048856	0.481	anatomical structure development
GO:0043547	0.440	positive regulation of GTPase activity
GO:0048519	0.417	negative regulation of biological process
GO:0048522	0.406	positive regulation of cellular process
GO:0048523	0.405	negative regulation of cellular process
GO:0007010	0.370	cytoskeleton organization
GO:0030334	0.329	regulation of cell migration
GO:0032501	0.325	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0043226	0.995	organelle
GO:0005886	0.993	plasma membrane
GO:0043229	0.992	intracellular organelle
GO:0030054	0.985	cell junction
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0045202	0.966	synapse
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0098978	0.742	glutamatergic synapse
GO:0031982	0.706	vesicle
GO:0098794	0.613	postsynapse
GO:0014069	0.319	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]