StarFunc result for job id Q12983

User Input

>input (259 residues)
MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQ
LPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
RSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSD
WIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLL
AIGLGIYIGRRLTTSTSTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12983	1.000	1.000	1.364E-40	259	1.000	1.000	Q12983.pdb.gz	BNIP3_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Homo sapiens OX=9606 GN=BNIP3 PE=1 SV=4
2	AFDB:O60238	0.206	0.240	7.670E-14	219	0.459	0.543	O60238.pdb.gz	BNI3L_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L PE=1 SV=1
3	AFDB:M9ND89	0.123	0.069	6.099E-3	541	0.139	0.067	M9ND89.pdb.gz	M9ND89_DROME Nuclear fallout, isoform J OS=Drosophila melanogaster OX=7227 GN=nuf PE=4 SV=1
4	AFDB:Q99359	0.082	0.040	2.078E-2	647	0.158	0.063	Q99359.pdb.gz	RAD61_YEAST Protein RAD61 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD61 PE=1 SV=1
5	AFDB:Q8BIZ6	0.113	0.083	2.234E-2	383	0.158	0.107	Q8BIZ6.pdb.gz	SNIP1_MOUSE Smad nuclear-interacting protein 1 OS=Mus musculus OX=10090 GN=Snip1 PE=1 SV=1
6	AFDB:O17966	0.113	0.048	1.261E-1	806	0.112	0.036	O17966.pdb.gz	TOP1_CAEEL DNA topoisomerase 1 OS=Caenorhabditis elegans OX=6239 GN=top-1 PE=2 SV=1
7	AFDB:Q9BL91	0.093	0.070	1.457E-1	369	0.147	0.103	Q9BL91.pdb.gz	Q9BL91_CAEEL Uncharacterized protein OS=Caenorhabditis elegans OX=6239 GN=rec-1 PE=4 SV=3
8	AFDB:Q14868	0.110	0.089	1.944E-1	337	0.135	0.104	Q14868.pdb.gz	Q14868_HUMAN Effector cell protease receptor 1 (Fragment) OS=Homo sapiens OX=9606 GN=EPR-1 PE=1 SV=1
9	AFDB:Q59XM1	0.087	0.041	2.246E-1	791	0.154	0.051	Q59XM1.pdb.gz	EXO84_CANAL Exocyst complex component EXO84 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EXO84 PE=3 SV=3
10	AFDB:O14639	0.115	0.051	2.414E-1	778	0.181	0.060	O14639.pdb.gz	ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3
11	PDB:7mq8SS	0.102	0.132	6.188	197	0.069	0.091	7mq8SS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7ajuCK	0.096	0.110	7.148	222	0.100	0.117	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12983	1.24e-142	399	194	0.749	1.000	BNIP3_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Homo sapiens OX=9606 GN=BNIP3 PE=1 SV=4
2	Q9ET45	2.32e-107	310	187	0.680	0.941	Q9ET45_RAT BCL2 interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Bnip3 PE=1 SV=1
3	O55003	6.71e-107	308	187	0.680	0.941	BNIP3_MOUSE BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Mus musculus OX=10090 GN=Bnip3 PE=1 SV=1
4	A0A8I6AQ99	4.14e-96	281	173	0.625	0.936	A0A8I6AQ99_RAT BCL2 interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Bnip3 PE=1 SV=1
5	A0A8I6AKI3	3.46e-62	196	200	0.444	0.575	A0A8I6AKI3_RAT BCL2 interacting protein 3 like OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=1 SV=1
6	A0A8I6AG85	3.35e-61	194	240	0.452	0.487	A0A8I6AG85_RAT BCL2 interacting protein 3 like OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=1 SV=1
7	Q66HQ4	4.75e-61	195	271	0.444	0.424	Q66HQ4_RAT Bnip3l protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=2 SV=1
8	Q8VBW4	7.12e-61	193	218	0.440	0.523	Q8VBW4_RAT BNIP3L protein OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=2 SV=1
9	Q58EQ7	1.24e-56	182	213	0.409	0.498	Q58EQ7_DANRE BCL2 interacting protein 3 like b OS=Danio rerio OX=7955 GN=bnip3l PE=2 SV=1
10	A0A8I6ACG8	1.25e-54	176	204	0.405	0.515	A0A8I6ACG8_RAT BCL2 interacting protein 3 like OS=Rattus norvegicus OX=10116 GN=Bnip3l PE=3 SV=1
11	Q9Z2F7	1.92e-54	176	218	0.440	0.523	BNI3L_MOUSE BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Mus musculus OX=10090 GN=Bnip3l PE=1 SV=1
12	O60238	5.31e-54	175	219	0.436	0.516	BNI3L_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L PE=1 SV=1
13	Q6IBV1	5.31e-54	175	219	0.436	0.516	Q6IBV1_HUMAN BCL2/adenovirus E1B 19kDa interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L PE=2 SV=1
14	H0YBC7	3.31e-47	157	185	0.398	0.557	H0YBC7_HUMAN BCL2 interacting protein 3 like (Fragment) OS=Homo sapiens OX=9606 GN=BNIP3L PE=1 SV=1
15	M9VYP0	4.90e-23	91.3	75	0.220	0.760	M9VYP0_RAT BCL2 interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Bnip3 PE=2 SV=1
16	Q09969	1.82e-06	49.7	221	0.181	0.213	BNIP3_CAEEL NIP3 homolog OS=Caenorhabditis elegans OX=6239 GN=dct-1 PE=1 SV=2
17	Q9VPD6	0.002	40.4	201	0.224	0.289	Q9VPD6_DROME BNIP3, isoform A OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=1 SV=1
18	Q8IPU8	0.018	37.7	193	0.212	0.285	Q8IPU8_DROME BNIP3, isoform B OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=3 SV=1
19	Q8IPU7	0.13	35.0	177	0.181	0.266	Q8IPU7_DROME BNIP3, isoform C OS=Drosophila melanogaster OX=7227 GN=BNIP3 PE=2 SV=1
20	P43144	2.7	31.6	479	0.108	0.058	ACHA9_RAT Neuronal acetylcholine receptor subunit alpha-9 OS=Rattus norvegicus OX=10116 GN=Chrna9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06553 BNIP3	8.3e-70	245.8	BNIP3
2	PF20070 DUF6466	4.2e+02	12.8	Family of unknown function (DUF6466)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000003236

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000020403	0.913	Ras homolog enriched in brain
2	9601.ENSPPYP00000012163	0.804	BCL2-like 1
3	9601.ENSPPYP00000020684	0.775	BCL2/adenovirus E1B 19kDa interacting protein 3-like
4	9601.ENSPPYP00000008889	0.755	GABA(A) receptor-associated protein
5	9601.ENSPPYP00000010339	0.738	BCL2, apoptosis regulator
6	9601.ENSPPYP00000008605	0.732	annotation not available
7	9601.ENSPPYP00000012214	0.731	Microtubule-associated protein 1 light chain 3 alpha
8	9601.ENSPPYP00000015180	0.726	Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transductio [...]
9	9601.ENSPPYP00000008538	0.690	GABA(A) receptor-associated protein-like 2
10	9601.ENSPPYP00000002052	0.659	PTEN induced putative kinase 1
11	9601.ENSPPYP00000022685	0.659	FUN14 domain containing 1
12	9601.ENSPPYP00000009414	0.650	Plays a central role in autophagy. Acts as core subunit of the PI3K complex that mediates formation of phosphatidylinositol 3- phosphate
13	9601.ENSPPYP00000006683	0.628	Hypoxia-inducible factor 1-alpha
14	9601.ENSPPYP00000007397	0.622	BCL2/adenovirus E1B 19kDa interacting protein 2
15	9601.ENSPPYP00000017966	0.587	BCL2/adenovirus E1B 19kDa interacting protein 1
16	9601.ENSPPYP00000023979	0.583	STEAP family member 3, metalloreductase
17	9601.ENSPPYP00000018899	0.571	Autophagy protein 5
18	9601.ENSPPYP00000003333	0.566	HRas proto-oncogene, GTPase
19	9601.ENSPPYP00000008923	0.564	Cellular tumor antigen p53
20	9601.ENSPPYP00000001838	0.558	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is rel [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0019899	0.949	enzyme binding
GO:0051020	0.720	GTPase binding
GO:0046983	0.568	protein dimerization activity
GO:0042803	0.468	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0043065	0.967	positive regulation of apoptotic process
GO:0007006	0.920	mitochondrial membrane organization
GO:0090559	0.899	regulation of membrane permeability
GO:0051179	0.863	localization
GO:0051881	0.846	regulation of mitochondrial membrane potential
GO:0019222	0.843	regulation of metabolic process
GO:0031323	0.791	regulation of cellular metabolic process
GO:0006839	0.748	mitochondrial transport
GO:0009894	0.700	regulation of catabolic process
GO:0051716	0.681	cellular response to stimulus
GO:0046902	0.670	regulation of mitochondrial membrane permeability
GO:0009893	0.490	positive regulation of metabolic process
GO:0008152	0.463	metabolic process
GO:0031329	0.414	regulation of cellular catabolic process
GO:0048519	0.391	negative regulation of biological process
GO:0051128	0.366	regulation of cellular component organization
GO:0071704	0.359	organic substance metabolic process
GO:0031325	0.330	positive regulation of cellular metabolic process
GO:0044237	0.324	cellular metabolic process
GO:0044238	0.312	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0005829	0.995	cytosol
GO:0016020	0.914	membrane
GO:0070013	0.755	intracellular organelle lumen
GO:0031981	0.672	nuclear lumen
GO:0005654	0.620	nucleoplasm
GO:0031967	0.590	organelle envelope
GO:0005740	0.446	mitochondrial envelope
GO:0031090	0.389	organelle membrane
GO:0005741	0.378	mitochondrial outer membrane
GO:0005635	0.377	nuclear envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]