StarFunc result for job id Q12986

User Input

>input (1120 residues)
MAEAPPVSGTFKFNTDAAEFIPQEKKNSGLNCGTQRRLDSNRIGRRNYSSPPPCHLSRQV
PYDEISAVHQHSYHPSGSKPKSQQTSFQSSPCNKSPKSHGLQNQPWQKLRNEKHHIRVKK
AQSLAEQTSDTAGLESSTRSESGTDLREHSPSESEKEVVGADPRGAKPKKATQFVYSYGR
GPKVKGKLKCEWSNRTTPKPEDAGPESTKPVGVFHPDSSEASSRKGVLDGYGARRNEQRR
YPQKRPPWEVEGARPRPGRNPPKQEGHRHTNAGHRNNMGPIPKDDLNERPAKSTCDSENL
AVINKSSRRVDQEKCTVRRQDPQVVSPFSRGKQNHVLKNVETHTGSLIEQLTTEKYECMV
CCELVRVTAPVWSCQSCYHVFHLNCIKKWARSPASQADGQSGWRCPACQNVSAHVPNTYT
CFCGKVKNPEWSRNEIPHSCGEVCRKKQPGQDCPHSCNLLCHPGPCPPCPAFMTKTCECG
RTRHTVRCGQAVSVHCSNPCENILNCGQHQCAELCHGGQCQPCQIILNQVCYCGSTSRDV
LCGTDVGKSDGFGDFSCLKICGKDLKCGNHTCSQVCHPQPCQQCPRLPQLVRCCPCGQTP
LSQLLELGSSSRKTCMDPVPSCGKVCGKPLPCGSLDFIHTCEKLCHEGDCGPCSRTSVIS
CRCSFRTKELPCTSLKSEDATFMCDKRCNKKRLCGRHKCNEICCVDKEHKCPLICGRKLR
CGLHRCEEPCHRGNCQTCWQASFDELTCHCGASVIYPPVPCGTRPPECTQTCARVHECDH
PVYHSCHSEEKCPPCTFLTQKWCMGKHEFRSNIPCHLVDISCGLPCSATLPCGMHKCQRL
CHKGECLVDEPCKQPCTTPRADCGHPCMAPCHTSSPCPVTACKAKVELQCECGRRKEMVI
CSEASSTYQRIAAISMASKITDMQLGGSVEISKLITKKEVHQARLECDEECSALERKKRL
AEAFHISEDSDPFNIRSSGSKFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKS
HSFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVCPPTTLTGVLEREM
QARPPPPIPHHRHQSDKNPGSSNLQKITKEPIIDYFDVQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AY10	0.645	0.648	0.000	1114	0.882	0.887	B1AY10.pdb.gz	NFX1_MOUSE Transcriptional repressor NF-X1 OS=Mus musculus OX=10090 GN=Nfx1 PE=1 SV=1
2	AFDB:Q12986	1.000	1.000	0.000	1120	1.000	1.000	Q12986.pdb.gz	NFX1_HUMAN Transcriptional repressor NF-X1 OS=Homo sapiens OX=9606 GN=NFX1 PE=1 SV=2
3	AFDB:A0A0K3AUE4	0.038	0.027	7.706E-3	1968	0.125	0.071	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
4	AFDB:Q14202	0.080	0.072	3.667E-2	1370	0.129	0.106	Q14202.pdb.gz	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
5	AFDB:Q8SZW9	0.035	0.037	1.037E-1	1015	0.112	0.123	Q8SZW9.pdb.gz	Q8SZW9_DROME LP05501p OS=Drosophila melanogaster OX=7227 GN=Alh PE=2 SV=1
6	PDB:6hd5u	0.044	0.173	1.344E-1	235	0.012	0.055	6hd5u.pdb.gz
7	AFDB:Q9UHC1	0.048	0.041	2.468E-1	1453	0.128	0.098	Q9UHC1.pdb.gz	MLH3_HUMAN DNA mismatch repair protein Mlh3 OS=Homo sapiens OX=9606 GN=MLH3 PE=1 SV=3
8	AFDB:Q7YSI9	0.037	0.036	2.615E-1	1654	0.138	0.093	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
9	PDB:8a3tU	0.046	0.311	2.849E-1	114	0.021	0.202	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
10	AFDB:A0A1D8PGH4	0.039	0.023	2.935E-1	2624	0.112	0.048	A0A1D8PGH4.pdb.gz	A0A1D8PGH4_CANAL 1-phosphatidylinositol-3-phosphate 5-kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FAB1 PE=4 SV=1
11	AFDB:P25653	0.039	0.029	2.935E-1	1609	0.097	0.068	P25653.pdb.gz	FIG2_YEAST Factor-induced gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG2 PE=1 SV=2
12	PDB:2kpyA	0.034	0.215	3.019E-1	108	0.015	0.157	2kpyA.pdb.gz
13	AFDB:M9NE38	0.041	0.026	3.698E-1	1912	0.136	0.079	M9NE38.pdb.gz	JV_DROME Protein javelin OS=Drosophila melanogaster OX=7227 GN=jv PE=4 SV=1
14	PDB:4b17A	0.044	0.120	3.803E-1	357	0.010	0.031	4b17A.pdb.gz	Crystal Structure of Rlmm, the 2'O-Ribose Methyltransferase for C2498 of Escherichia Coli 23S Rrna.
15	PDB:4a2iH	0.048	0.304	4.269E-1	129	0.009	0.078	4a2iH.pdb.gz	Cryo-Electron Microscopy Structure of the 30S Subunit in Complex with the Yjeq Biogenesis Factor.
16	PDB:4lecA	0.047	0.194	4.269E-1	202	0.008	0.045	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
17	PDB:5nrlG	0.050	0.131	5.077E-1	372	0.031	0.094	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
18	PDB:7tveF	0.045	0.147	5.077E-1	270	0.011	0.044	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
19	PDB:7wttq	0.039	0.159	5.379E-1	235	0.013	0.060	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
20	PDB:4v6iAH	0.047	0.296	6.038E-1	130	0.007	0.062	4v6iAH.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AY10	0.0	1964	1114	0.882	0.887	NFX1_MOUSE Transcriptional repressor NF-X1 OS=Mus musculus OX=10090 GN=Nfx1 PE=1 SV=1
2	P40798	0.0	640	1106	0.307	0.311	STC_DROME Protein shuttle craft OS=Drosophila melanogaster OX=7227 GN=stc PE=1 SV=2
3	Q12986	0.0	2289	1120	1.000	1.000	NFX1_HUMAN Transcriptional repressor NF-X1 OS=Homo sapiens OX=9606 GN=NFX1 PE=1 SV=2
4	Q9SY59	7.72e-157	499	1188	0.294	0.277	NFXL1_ARATH NF-X1-type zinc finger protein NFXL1 OS=Arabidopsis thaliana OX=3702 GN=NFXL1 PE=1 SV=1
5	O74853	3.19e-142	458	1077	0.254	0.265	FAP1H_SCHPO FKBP12-associated protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fap1 PE=1 SV=1
6	Q57VH9	2.50e-97	322	545	0.178	0.365	Q57VH9_TRYB2 Nuclear transcription factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.2H15.360 PE=3 SV=1
7	P53971	5.97e-96	330	965	0.234	0.272	FAP1_YEAST FKBP12-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FAP1 PE=1 SV=1
8	Q6ZNB6	4.49e-64	237	911	0.201	0.247	NFXL1_HUMAN NF-X1-type zinc finger protein NFXL1 OS=Homo sapiens OX=9606 GN=NFXL1 PE=1 SV=2
9	Q9FFK8	8.50e-62	230	883	0.153	0.194	NFXL2_ARATH NF-X1-type zinc finger protein NFXL2 OS=Arabidopsis thaliana OX=3702 GN=NFXL2 PE=1 SV=2
10	Q8R151	3.27e-05	50.8	1909	0.089	0.052	ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Znfx1 PE=1 SV=3
11	F4JZ26	6.00e-04	45.1	245	0.021	0.094	F4JZ26_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ATARRE PE=4 SV=1
12	Q9P2E3	0.007	43.1	1918	0.055	0.032	ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=ZNFX1 PE=1 SV=2
13	O75391	0.092	38.1	227	0.019	0.093	SPAG7_HUMAN Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2
14	Q9SLC3	0.23	37.0	236	0.028	0.131	ATL41_ARATH E3 ubiquitin-protein ligase ATL41 OS=Arabidopsis thaliana OX=3702 GN=ATL41 PE=1 SV=1
15	Q9LW05	0.32	36.6	224	0.020	0.098	Q9LW05_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At3g15740 PE=4 SV=1
16	H6TS39	0.41	36.6	280	0.018	0.071	H6TS39_MAIZE Ring finger protein OS=Zea mays OX=4577 GN=RFP1 PE=2 SV=1
17	Q7K1R6	0.49	36.2	263	0.020	0.084	Q7K1R6_DROME LD46221p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10916 PE=1 SV=1
18	Q9N3H6	0.65	35.4	192	0.014	0.083	Q9N3H6_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y52E8A.2 PE=1 SV=1
19	O94265	0.81	36.2	506	0.026	0.057	THI21_SCHPO Putative hydroxymethylpyrimidine/phosphomethylpyrimidine kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP8B7.17c PE=3 SV=1
20	Q8MSX1	0.89	36.2	1818	0.021	0.013	ENC_DROME Protein encore OS=Drosophila melanogaster OX=7227 GN=enc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01424 R3H	2.1e-17	74.2	R3H domain
2	PF00867 XPG_I	6.7e+02	12.1	XPG I-region
3	PF01422 zf-NF-X1	4.9e-12	57.0	NF-X1 type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232165	0.932	Ubiquitin-protein ligase E3A
2	9606.ENSP00000379412	0.819	Zinc finger NFX1-type containing 1
3	9606.ENSP00000326366	0.800	Presenilin-1
4	9606.ENSP00000313007	0.793	Polyadenylate-binding protein 1
5	9606.ENSP00000368265	0.721	Ciliary neurotrophic factor receptor subunit alpha
6	9606.ENSP00000421592	0.698	THO complex subunit 4
7	9606.ENSP00000378786	0.643	HLA class II histocompatibility antigen, DR alpha chain
8	9606.ENSP00000392025	0.639	Ubiquitin carboxyl-terminal hydrolase CYLD
9	9606.ENSP00000450832	0.632	Signal-induced proliferation-associated 1-like protein 1
10	9606.ENSP00000384302	0.627	WD repeat-containing protein 43
11	9606.ENSP00000368970	0.626	Ubiquitin-fold modifier 1
12	9606.ENSP00000482767	0.612	La-related protein 4B
13	9606.ENSP00000327465	0.604	Myelin transcription factor 1
14	9606.ENSP00000225792	0.602	Probable ATP-dependent RNA helicase DDX5
15	9606.ENSP00000320434	0.601	Alpha-catulin
16	9606.ENSP00000470142	0.582	Regulator of nonsense transcripts 1
17	9606.ENSP00000382840	0.579	ATP-dependent RNA helicase DDX3X
18	9606.ENSP00000361626	0.549	Nuclease-sensitive element-binding protein 1
19	9606.ENSP00000381717	0.544	Ubiquitin-conjugating enzyme E2 D2
20	9606.ENSP00000359385	0.539	Glomulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.998	RNA binding
GO:0003677	0.984	DNA binding
GO:0003824	0.977	catalytic activity
GO:0043565	0.957	sequence-specific DNA binding
GO:0061630	0.939	ubiquitin protein ligase activity
GO:0001227	0.935	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.929	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0000122	0.978	negative regulation of transcription by RNA polymerase II
GO:0009987	0.920	cellular process
GO:0071704	0.919	organic substance metabolic process
GO:0044237	0.751	cellular metabolic process
GO:0044238	0.741	primary metabolic process
GO:0006807	0.708	nitrogen compound metabolic process
GO:0043170	0.708	macromolecule metabolic process
GO:0034641	0.577	cellular nitrogen compound metabolic process
GO:0010467	0.572	gene expression
GO:1901360	0.544	organic cyclic compound metabolic process
GO:0006725	0.515	cellular aromatic compound metabolic process
GO:0006139	0.511	nucleobase-containing compound metabolic process
GO:1901564	0.510	organonitrogen compound metabolic process
GO:0050896	0.507	response to stimulus
GO:0019538	0.498	protein metabolic process
GO:0090304	0.424	nucleic acid metabolic process
GO:0016070	0.404	RNA metabolic process
GO:0044271	0.372	cellular nitrogen compound biosynthetic process
GO:0009059	0.356	macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:0016020	0.997	membrane
GO:0005730	0.991	nucleolus
GO:0071944	0.990	cell periphery
GO:0005886	0.970	plasma membrane
GO:0032991	0.506	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.939	Transferases.

[back to server]