StarFunc result for job id Q13002

User Input

>input (908 residues)
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:4uqqA	0.681	0.884	0.000	693	0.758	0.993	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
2	PDB:5kufA	0.701	0.842	0.000	750	0.816	0.988	5kufA.pdb.gz	Structural basis of kainate subtype glutamate receptor desensitization.
3	AFDB:B1AS29	0.825	0.815	0.000	919	0.792	0.782	B1AS29.pdb.gz	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
4	AFDB:E7ENK3	0.838	0.803	0.000	949	0.771	0.738	E7ENK3.pdb.gz	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
5	AFDB:P39087	0.865	0.865	0.000	908	0.990	0.990	P39087.pdb.gz	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
6	AFDB:Q60934	0.626	0.678	0.000	836	0.662	0.719	Q60934.pdb.gz	GRIK1_MOUSE Glutamate receptor ionotropic, kainate 1 OS=Mus musculus OX=10090 GN=Grik1 PE=2 SV=2
7	PDB:7vm2B	0.399	0.490	1.027E-98	736	0.667	0.823	7vm2B.pdb.gz
8	AFDB:Q9VDH5	0.759	0.804	3.306E-95	853	0.446	0.475	Q9VDH5.pdb.gz	Q9VDH5_DROME Kainate-type ionotropic glutamate receptor subunit 1D OS=Drosophila melanogaster OX=7227 GN=KaiR1D PE=1 SV=1
9	AFDB:Q16478	0.726	0.676	6.896E-94	980	0.434	0.402	Q16478.pdb.gz	GRIK5_HUMAN Glutamate receptor ionotropic, kainate 5 OS=Homo sapiens OX=9606 GN=GRIK5 PE=2 SV=2
10	AFDB:Q01812	0.750	0.716	2.227E-93	956	0.428	0.407	Q01812.pdb.gz	GRIK4_RAT Glutamate receptor ionotropic, kainate 4 OS=Rattus norvegicus OX=10116 GN=Grik4 PE=1 SV=1
11	AFDB:Q0KIF2	0.722	0.729	1.011E-89	899	0.370	0.374	Q0KIF2.pdb.gz	Q0KIF2_DROME Eye-enriched kainate receptor, isoform B OS=Drosophila melanogaster OX=7227 GN=Ekar PE=3 SV=1
12	AFDB:A0A0R4ING5	0.599	0.602	7.991E-88	903	0.376	0.378	A0A0R4ING5.pdb.gz
13	AFDB:P19493	0.447	0.450	3.910E-86	902	0.379	0.381	P19493.pdb.gz	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
14	PDB:7rz4A	0.612	0.564	7.646E-77	993	0.360	0.329	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:7ocaA	0.504	0.573	3.363E-75	775	0.371	0.435	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
16	PDB:7rzaA	0.560	0.524	1.664E-74	981	0.361	0.334	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
17	PDB:5kbtA	0.617	0.579	1.247E-72	973	0.352	0.329	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
18	PDB:5weoA	0.590	0.548	2.893E-71	988	0.363	0.334	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:4u1wA	0.610	0.741	4.877E-70	731	0.328	0.408	4u1wA.pdb.gz	Structure and Dynamics of AMPA Receptor GluA2 in Resting, Pre-Open, and Desensitized States.
20	PDB:5idfB	0.388	0.474	5.143E-70	734	0.343	0.424	5idfB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A023GQ97	666	898	0.389	0.393	A0A023GQ97_DROME Eye-enriched kainate receptor, isoform D OS=Drosophila melanogaster OX=7227 GN=Ekar PE=3 SV=1
2	B1AS29	1530	919	0.789	0.779	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
3	E7ENK3	1457	949	0.762	0.729	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	E9PD61	1462	920	0.776	0.766	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
5	F7AGW3	1458	949	0.762	0.729	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
6	H7BYG7	1454	871	0.758	0.790	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
7	P19490	639	907	0.387	0.387	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
8	P19491	627	883	0.382	0.393	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
9	P19492	629	888	0.395	0.404	GRIA3_RAT Glutamate receptor 3 OS=Rattus norvegicus OX=10116 GN=Gria3 PE=1 SV=1
10	P19493	605	902	0.379	0.381	GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1
11	P22756	1438	949	0.752	0.720	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
12	P23818	642	907	0.389	0.389	GRIA1_MOUSE Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1
13	P23819	628	883	0.382	0.393	GRIA2_MOUSE Glutamate receptor 2 OS=Mus musculus OX=10090 GN=Gria2 PE=1 SV=3
14	P39086	1455	918	0.760	0.752	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
15	P39087	1878	908	0.990	0.990	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
16	P42260	1879	908	0.991	0.991	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
17	P42261	638	906	0.385	0.386	GRIA1_HUMAN Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2
18	P42262	630	883	0.380	0.391	GRIA2_HUMAN Glutamate receptor 2 OS=Homo sapiens OX=9606 GN=GRIA2 PE=1 SV=3
19	P42263	630	894	0.396	0.403	GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens OX=9606 GN=GRIA3 PE=1 SV=2
20	P42264	1531	919	0.790	0.780	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	7.7e-79	277.0	Receptor family ligand binding region
2	PF00060 Lig_chan	1.3e-51	185.8	Ligand-gated ion channel
3	PF10613 Lig_chan-Glu_bd	1e-42	156.3	Ligated ion channel L-glutamate- and glycine-binding site
4	PF13458 Peripla_BP_6	0.0008	30.9	Periplasmic binding protein
5	PF00497 SBP_bac_3	1.3e-14	65.7	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.999	Disks large homolog 4
2	9606.ENSP00000262895	0.975	Glutamate receptor ionotropic, kainate 5
3	9606.ENSP00000455169	0.943	Neuropilin and tolloid-like protein 2
4	9606.ENSP00000345731	0.941	Disks large homolog 1
5	9606.ENSP00000325448	0.928	Lysine--tRNA ligase
6	9606.ENSP00000385205	0.917	PRKCA-binding protein
7	9606.ENSP00000363480	0.913	Disks large homolog 3
8	9606.ENSP00000387694	0.913	Solute carrier family 12 member 5
9	9606.ENSP00000337168	0.912	Band 4.1-like protein 1
10	9606.ENSP00000247986	0.888	Kinesin-like protein KIF17
11	9606.ENSP00000381098	0.869	Glutamate receptor-interacting protein 1
12	9606.ENSP00000344456	0.862	Catenin beta-1
13	9606.ENSP00000309597	0.846	Mitogen-activated protein kinase kinase kinase 11
14	9606.ENSP00000382791	0.841	Glutamate receptor ionotropic, kainate 1
15	9606.ENSP00000395012	0.826	Kelch-like protein 24
16	9606.ENSP00000300105	0.821	Voltage-dependent calcium channel gamma-2 subunit
17	9606.ENSP00000428994	0.796	Glutamate receptor 1
18	9606.ENSP00000313088	0.795	Neuropilin and tolloid-like protein 1
19	9606.ENSP00000360608	0.783	Glutamate receptor ionotropic, NMDA 1
20	9606.ENSP00000435648	0.746	Glutamate receptor ionotropic, kainate 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099094	0.999	ligand-gated monoatomic cation channel activity
GO:0005272	0.999	sodium channel activity
GO:0004970	0.999	ionotropic glutamate receptor activity
GO:0005515	0.998	protein binding
GO:0005267	0.998	potassium channel activity
GO:0015277	0.643	kainate selective glutamate receptor activity
GO:0099507	0.582	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0099529	0.464	neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential
GO:1904315	0.448	transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
GO:0005262	0.436	calcium channel activity
GO:0042802	0.361	identical protein binding
GO:0019899	0.353	enzyme binding
GO:0030165	0.301	PDZ domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0023052	0.993	signaling
GO:0007154	0.993	cell communication
GO:0050896	0.976	response to stimulus
GO:0010646	0.961	regulation of cell communication
GO:0023051	0.957	regulation of signaling
GO:0007267	0.953	cell-cell signaling
GO:0099177	0.949	regulation of trans-synaptic signaling
GO:0007165	0.949	signal transduction
GO:0042391	0.947	regulation of membrane potential
GO:0099537	0.942	trans-synaptic signaling
GO:0098916	0.932	anterograde trans-synaptic signaling
GO:0007268	0.921	chemical synaptic transmission
GO:0007215	0.906	glutamate receptor signaling pathway
GO:0050804	0.882	modulation of chemical synaptic transmission
GO:0048522	0.783	positive regulation of cellular process
GO:0032501	0.687	multicellular organismal process
GO:0048519	0.623	negative regulation of biological process
GO:0048523	0.610	negative regulation of cellular process
GO:0048168	0.598	regulation of neuronal synaptic plasticity
GO:0051966	0.564	regulation of synaptic transmission, glutamatergic
GO:0050805	0.450	negative regulation of synaptic transmission
GO:0051179	0.420	localization
GO:0006810	0.390	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.997	cell junction
GO:0005737	0.986	cytoplasm
GO:0045202	0.978	synapse
GO:0032991	0.976	protein-containing complex
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0042995	0.860	cell projection
GO:0036477	0.827	somatodendritic compartment
GO:0098796	0.791	membrane protein complex
GO:0098797	0.759	plasma membrane protein complex
GO:0034702	0.755	ion channel complex
GO:0043005	0.696	neuron projection
GO:0043235	0.676	receptor complex
GO:0098794	0.555	postsynapse
GO:0098802	0.551	plasma membrane signaling receptor complex
GO:0030425	0.457	dendrite
GO:0008328	0.456	ionotropic glutamate receptor complex
GO:0098793	0.386	presynapse
GO:0070013	0.378	intracellular organelle lumen
GO:0098978	0.349	glutamatergic synapse
GO:0043025	0.344	neuronal cell body
GO:0098590	0.328	plasma membrane region
GO:0005634	0.316	nucleus
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.999	Na(+)(in) = Na(+)(out)
RHEA:29463	0.999	K(+)(in) = K(+)(out)
RHEA:29671	0.436	Ca(2+)(in) = Ca(2+)(out)

[back to server]