StarFunc result for job id Q13009

User Input

>input (1591 residues)
MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDTEESRLYGDDATYLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRQLSTCQRANSLGDLYAQKN
SGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPT
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
EAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINN
RAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTS
NPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPS
PQDSTGPQLATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
RELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGRKTLDSHASRMAQLKKQAALS
GINGGLESASEEVIWVRREDFAPSRKLNTEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13009	1.000	1.000	0.000	1591	1.000	1.000	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
2	AFDB:Q9VW85	0.129	0.125	2.029E-16	1661	0.141	0.135	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
3	AFDB:Q9VZ85	0.135	0.110	5.670E-16	1984	0.138	0.110	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
4	PDB:4mt6A	0.135	0.445	6.007E-15	389	0.049	0.201	4mt6A.pdb.gz
5	PDB:7rx9A	0.114	0.395	6.294E-15	432	0.060	0.222	7rx9A.pdb.gz
6	AFDB:M9PHU0	0.140	0.109	8.403E-14	2263	0.122	0.086	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
7	AFDB:Q54YZ6	0.130	0.157	4.517E-13	1218	0.106	0.138	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
8	AFDB:Q6ZNL6	0.111	0.120	6.264E-13	1462	0.137	0.149	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
9	AFDB:Q12774	0.129	0.128	1.433E-11	1597	0.122	0.121	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
10	AFDB:P34288	0.064	0.064	1.349E-10	1605	0.133	0.131	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
11	AFDB:M9NFI9	0.052	0.039	2.526E-8	2148	0.130	0.096	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
12	PDB:4gouA	0.104	0.302	3.120E-8	507	0.037	0.116	4gouA.pdb.gz
13	AFDB:E7EY47	0.128	0.193	5.090E-8	958	0.088	0.146	E7EY47.pdb.gz	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
14	PDB:6bbpA	0.057	0.168	8.776E-5	520	0.016	0.048	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:6u3eA	0.055	0.214	2.234E-4	397	0.016	0.063	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:7pcbA	0.051	0.184	7.183E-4	415	0.037	0.142	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7pc3A	0.050	0.186	8.263E-4	405	0.014	0.054	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:7p73A	0.049	0.175	9.506E-4	420	0.014	0.052	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:6s9wA	0.059	0.214	1.146E-3	411	0.013	0.049	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
20	PDB:6t36A	0.050	0.725	1.318E-3	93	0.013	0.226	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AC12	0.0	3050	1590	0.951	0.952	A0A8I6AC12_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=4 SV=1
2	A0A8I6G1W3	0.0	1188	622	0.360	0.921	A0A8I6G1W3_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=4 SV=1
3	D3ZWV8	0.0	2982	1588	0.935	0.937	D3ZWV8_RAT TIAM Rac1 associated GEF 1 OS=Rattus norvegicus OX=10116 GN=Tiam1 PE=1 SV=4
4	Q13009	0.0	3303	1591	1.000	1.000	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
5	Q60610	0.0	3065	1591	0.954	0.954	TIAM1_MOUSE Rho guanine nucleotide exchange factor TIAM1 OS=Mus musculus OX=10090 GN=Tiam1 PE=1 SV=1
6	Q6ZPF3	0.0	961	1715	0.368	0.341	TIAM2_MOUSE Rho guanine nucleotide exchange factor TIAM2 OS=Mus musculus OX=10090 GN=Tiam2 PE=1 SV=2
7	Q8IVF5	0.0	986	1701	0.371	0.347	TIAM2_HUMAN Rho guanine nucleotide exchange factor TIAM2 OS=Homo sapiens OX=9606 GN=TIAM2 PE=2 SV=4
8	P91620	4.34e-118	415	2061	0.163	0.126	SIF2_DROME Protein still life, isoforms C/SIF type 2 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
9	P91621	1.12e-113	401	2072	0.168	0.129	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
10	Q9QX73	5.14e-25	113	493	0.055	0.178	ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus OX=10116 GN=Arhgef9 PE=1 SV=1
11	A0A0A6YYF8	5.61e-25	114	564	0.055	0.154	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
12	A0A1B0GV84	7.33e-25	112	506	0.055	0.172	A0A1B0GV84_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
13	Q69ZK0	9.86e-25	115	1650	0.072	0.070	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
14	A0A1B0GWI5	9.95e-25	112	529	0.055	0.164	A0A1B0GWI5_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
15	A0A5F9ZGZ3	1.02e-24	112	489	0.055	0.178	A0A5F9ZGZ3_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
16	A0A5F9ZHY9	1.08e-24	112	523	0.055	0.166	A0A5F9ZHY9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
17	A0A1B0GVC4	1.25e-24	111	454	0.055	0.192	A0A1B0GVC4_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
18	Q3UTH8	1.27e-24	112	516	0.055	0.169	ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus OX=10090 GN=Arhgef9 PE=1 SV=1
19	B1AMR3	1.46e-24	112	495	0.055	0.176	B1AMR3_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
20	Q5JYA6	1.51e-24	114	1385	0.049	0.056	Q5JYA6_HUMAN PLEKHG1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	85	14.9	AAA domain
2	PF00595 PDZ	0.00016	33.3	PDZ domain
3	PF13180 PDZ_2	0.45	22.2	PDZ domain
4	PF17820 PDZ_6	0.58	21.4	PDZ domain
5	PF02163 Peptidase_M50	20	15.9	Peptidase family M50
6	PF00169 PH	8.8e-23	92.2	PH domain
7	PF15413 PH_11	33	16.4	Pleckstrin homology domain
8	PF15410 PH_9	2.2e-05	36.0	Pleckstrin homology domain
9	PF02196 RBD	5.9e-13	59.9	Raf-like Ras-binding domain
10	PF00621 RhoGEF	3.9e-38	143.0	RhoGEF domain
11	PF18385 Tiam_CC_Ex	9.8e-32	120.3	T-lymphoma invasion and metastasis CC-Ex domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337060	0.998	Nucleoside diphosphate kinase A
2	9606.ENSP00000363763	0.996	Ephrin type-B receptor 2
3	9606.ENSP00000398632	0.996	CD44 antigen
4	9606.ENSP00000348461	0.995	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000383118	0.992	Cell division control protein 42 homolog
6	9606.ENSP00000363921	0.987	Partitioning defective 3 homolog
7	9606.ENSP00000451828	0.983	RAC-alpha serine/threonine-protein kinase
8	9606.ENSP00000400175	0.982	Transforming protein RhoA
9	9606.ENSP00000256078	0.980	GTPase KRas
10	9606.ENSP00000362680	0.980	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000277120	0.977	BDNF/NT-3 growth factors receptor
12	9606.ENSP00000298316	0.974	ADP-ribosylation factor 6
13	9606.ENSP00000367830	0.974	Protein kinase C zeta type
14	9606.ENSP00000381097	0.973	Ephrin type-B receptor 1
15	9606.ENSP00000249071	0.972	Ras-related C3 botulinum toxin substrate 2
16	9606.ENSP00000407586	0.972	GTPase HRas
17	9606.ENSP00000370542	0.966	Syndecan-1
18	9606.ENSP00000304283	0.962	Ras-related C3 botulinum toxin substrate 3
19	9606.ENSP00000204961	0.945	Ephrin-B1
20	9606.ENSP00000219255	0.944	Partitioning defective 6 homolog alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005102	0.998	signaling receptor binding
GO:0019901	0.997	protein kinase binding
GO:0008092	0.995	cytoskeletal protein binding
GO:0030971	0.977	receptor tyrosine kinase binding
GO:0008017	0.972	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0051128	0.989	regulation of cellular component organization
GO:0050790	0.987	regulation of catalytic activity
GO:0044093	0.986	positive regulation of molecular function
GO:0009987	0.985	cellular process
GO:0016043	0.983	cellular component organization
GO:0048583	0.982	regulation of response to stimulus
GO:0022603	0.981	regulation of anatomical structure morphogenesis
GO:0007165	0.979	signal transduction
GO:0051345	0.976	positive regulation of hydrolase activity
GO:0023051	0.975	regulation of signaling
GO:0010646	0.975	regulation of cell communication
GO:0009966	0.971	regulation of signal transduction
GO:0120035	0.968	regulation of plasma membrane bounded cell projection organization
GO:0043547	0.967	positive regulation of GTPase activity
GO:0051239	0.964	regulation of multicellular organismal process
GO:0007166	0.964	cell surface receptor signaling pathway
GO:0010975	0.960	regulation of neuron projection development
GO:0031346	0.958	positive regulation of cell projection organization
GO:0090630	0.949	activation of GTPase activity
GO:1902531	0.935	regulation of intracellular signal transduction
GO:0051960	0.875	regulation of nervous system development
GO:0051056	0.870	regulation of small GTPase mediated signal transduction
GO:0051962	0.869	positive regulation of nervous system development
GO:0045595	0.867	regulation of cell differentiation
GO:0050769	0.859	positive regulation of neurogenesis
GO:0007167	0.855	enzyme-linked receptor protein signaling pathway
GO:0050770	0.847	regulation of axonogenesis
GO:0050772	0.843	positive regulation of axonogenesis
GO:0035556	0.831	intracellular signal transduction
GO:0030334	0.799	regulation of cell migration
GO:0007169	0.776	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048584	0.749	positive regulation of response to stimulus
GO:0019222	0.746	regulation of metabolic process
GO:0032501	0.743	multicellular organismal process
GO:0032502	0.742	developmental process
GO:0010976	0.733	positive regulation of neuron projection development
GO:0048856	0.719	anatomical structure development
GO:0060255	0.708	regulation of macromolecule metabolic process
GO:0031323	0.700	regulation of cellular metabolic process
GO:0080090	0.692	regulation of primary metabolic process
GO:0009893	0.688	positive regulation of metabolic process
GO:0051171	0.677	regulation of nitrogen compound metabolic process
GO:0065008	0.669	regulation of biological quality
GO:0010604	0.661	positive regulation of macromolecule metabolic process
GO:0007264	0.581	small GTPase mediated signal transduction
GO:0050803	0.549	regulation of synapse structure or activity
GO:0030335	0.547	positive regulation of cell migration
GO:0048013	0.521	ephrin receptor signaling pathway
GO:0010647	0.505	positive regulation of cell communication
GO:0023056	0.504	positive regulation of signaling
GO:0031325	0.496	positive regulation of cellular metabolic process
GO:0048731	0.494	system development
GO:0051173	0.463	positive regulation of nitrogen compound metabolic process
GO:0019220	0.460	regulation of phosphate metabolic process
GO:0031399	0.449	regulation of protein modification process
GO:0051247	0.444	positive regulation of protein metabolic process
GO:0009967	0.436	positive regulation of signal transduction
GO:0048869	0.419	cellular developmental process
GO:0001932	0.411	regulation of protein phosphorylation
GO:1902533	0.411	positive regulation of intracellular signal transduction
GO:0030154	0.407	cell differentiation
GO:0099175	0.396	regulation of postsynapse organization
GO:0022604	0.390	regulation of cell morphogenesis
GO:0045937	0.386	positive regulation of phosphate metabolic process
GO:0045860	0.365	positive regulation of protein kinase activity
GO:0048519	0.363	negative regulation of biological process
GO:0009653	0.363	anatomical structure morphogenesis
GO:0061001	0.355	regulation of dendritic spine morphogenesis
GO:0043507	0.347	positive regulation of JUN kinase activity
GO:0048523	0.346	negative regulation of cellular process
GO:0007399	0.339	nervous system development
GO:0051179	0.316	localization
GO:0048468	0.314	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005886	0.994	plasma membrane
GO:0005829	0.994	cytosol
GO:0030054	0.993	cell junction
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005856	0.988	cytoskeleton
GO:0120025	0.983	plasma membrane bounded cell projection
GO:0019897	0.983	extrinsic component of plasma membrane
GO:0005634	0.967	nucleus
GO:0043005	0.950	neuron projection
GO:0098890	0.916	extrinsic component of postsynaptic membrane
GO:0098892	0.906	extrinsic component of postsynaptic specialization membrane
GO:0030424	0.905	axon
GO:0030426	0.903	growth cone
GO:0070161	0.853	anchoring junction
GO:0005576	0.839	extracellular region
GO:0031252	0.835	cell leading edge
GO:0044297	0.834	cell body
GO:0032587	0.825	ruffle membrane
GO:0036477	0.807	somatodendritic compartment
GO:0032279	0.807	asymmetric synapse
GO:0044295	0.806	axonal growth cone
GO:0044309	0.792	neuron spine
GO:0014069	0.760	postsynaptic density
GO:0097447	0.727	dendritic tree
GO:0030425	0.717	dendrite
GO:0015630	0.715	microtubule cytoskeleton
GO:0043197	0.709	dendritic spine
GO:0098839	0.698	postsynaptic density membrane
GO:0005615	0.670	extracellular space
GO:0012505	0.664	endomembrane system
GO:0032991	0.602	protein-containing complex
GO:0031982	0.570	vesicle
GO:0005911	0.511	cell-cell junction
GO:0070013	0.447	intracellular organelle lumen
GO:0099080	0.445	supramolecular complex
GO:0043025	0.405	neuronal cell body
GO:0031981	0.390	nuclear lumen
GO:0031410	0.380	cytoplasmic vesicle
GO:0099512	0.360	supramolecular fiber
GO:0044291	0.358	cell-cell contact zone
GO:0098978	0.316	glutamatergic synapse
GO:0005654	0.316	nucleoplasm
GO:0031234	0.311	extrinsic component of cytoplasmic side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]