StarFunc result for job id Q13011

User Input

>input (328 residues)
MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRV
TSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDL
MDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVT
ACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGS
GLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMS
MLQTQDLVKSVQATTENKELKTVTFSKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13011	1.000	1.000	9.670E-66	328	1.000	1.000	Q13011.pdb.gz	ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2
2	AFDB:O35459	0.898	0.901	8.357E-57	327	0.741	0.743	O35459.pdb.gz	ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus OX=10090 GN=Ech1 PE=1 SV=1
3	AFDB:Q9FHR8	0.817	0.961	1.627E-34	278	0.375	0.442	Q9FHR8.pdb.gz	DCI1_ARATH Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=DCI1 PE=1 SV=1
4	AFDB:P75019	0.676	0.807	1.453E-27	274	0.326	0.391	P75019.pdb.gz	P75019_MYCTU Possible enoyl-CoA hydratase EchA21 (Enoyl hydrase) (Unsaturated acyl-CoA hydratase) (Crotonase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA21 PE=1 SV=1
5	AFDB:C8V3K8	0.738	0.833	1.008E-23	289	0.262	0.298	C8V3K8.pdb.gz	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
6	AFDB:Q7JR58	0.730	0.806	4.021E-23	295	0.229	0.254	Q7JR58.pdb.gz	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
7	AFDB:P9WNN7	0.727	0.831	4.270E-23	285	0.238	0.274	P9WNN7.pdb.gz	ECH12_MYCTU Probable enoyl-CoA hydratase EchA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA12 PE=1 SV=1
8	AFDB:F4JML5	0.725	0.787	5.115E-23	301	0.232	0.252	F4JML5.pdb.gz	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
9	AFDB:P76082	0.701	0.892	9.336E-23	255	0.232	0.298	P76082.pdb.gz	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
10	PDB:5zaiC	0.733	0.919	1.808E-22	259	0.226	0.286	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
11	AFDB:P9WNN9	0.715	0.903	2.041E-22	257	0.250	0.319	P9WNN9.pdb.gz	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
12	PDB:3h81A	0.723	0.914	9.747E-22	256	0.253	0.324	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
13	PDB:7oeqA	0.683	0.857	9.030E-21	259	0.229	0.290	7oeqA.pdb.gz
14	PDB:4fzwB	0.727	0.922	1.376E-20	256	0.250	0.320	4fzwB.pdb.gz
15	PDB:4izcB	0.719	0.878	3.008E-20	266	0.210	0.259	4izcB.pdb.gz	Crystal Structure of DmdD, a Crotonase Superfamily Enzyme That Catalyzes the Hydration and Hydrolysis of Methylthioacryloyl-CoA.
16	PDB:2hw5C	0.710	0.886	6.193E-20	260	0.216	0.273	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
17	PDB:1dubA	0.725	0.903	3.143E-19	260	0.223	0.281	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
18	PDB:6wyiA	0.660	0.904	3.545E-19	237	0.229	0.316	6wyiA.pdb.gz
19	PDB:5dtwC	0.563	0.737	1.112E-18	246	0.235	0.313	5dtwC.pdb.gz	THPP target assignment reveals EchA6 as an essential fatty acid shuttle in mycobacteria.
20	PDB:1jxzB	0.706	0.851	1.596E-18	269	0.201	0.245	1jxzB.pdb.gz	Histidine 90 Function in 4-chlorobenzoyl-coenzyme A Dehalogenase Catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35459	0.0	525	327	0.741	0.743	ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus OX=10090 GN=Ech1 PE=1 SV=1
2	Q13011	0.0	678	328	1.000	1.000	ECH1_HUMAN Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens OX=9606 GN=ECH1 PE=1 SV=2
3	Q62651	0.0	530	327	0.759	0.761	ECH1_RAT Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ech1 PE=1 SV=2
4	Q9FHR8	4.45e-72	226	278	0.369	0.435	DCI1_ARATH Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=DCI1 PE=1 SV=1
5	P75019	8.01e-52	174	274	0.332	0.398	P75019_MYCTU Possible enoyl-CoA hydratase EchA21 (Enoyl hydrase) (Unsaturated acyl-CoA hydratase) (Crotonase) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA21 PE=1 SV=1
6	P31551	5.57e-32	122	261	0.277	0.349	CAID_ECOLI Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) OX=83333 GN=caiD PE=1 SV=4
7	P76082	1.15e-30	118	255	0.232	0.298	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
8	F4JML5	6.37e-30	117	301	0.238	0.259	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
9	C8V3K8	1.14e-28	114	289	0.250	0.284	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
10	G4V4T7	2.97e-28	112	265	0.253	0.313	DPGD_AMYOR Enoyl-CoA-hydratase OS=Amycolatopsis orientalis OX=31958 GN=dpgD PE=1 SV=1
11	P9WNN7	5.72e-28	112	285	0.259	0.298	ECH12_MYCTU Probable enoyl-CoA hydratase EchA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA12 PE=1 SV=1
12	P9WNP1	6.80e-28	110	243	0.247	0.333	ECHA6_MYCTU Probable enoyl-CoA hydratase EchA6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA6 PE=1 SV=1
13	A4YI89	1.44e-27	110	259	0.235	0.297	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
14	P9WNN9	5.45e-27	108	257	0.253	0.323	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
15	O53561	2.18e-26	107	266	0.223	0.274	ECH19_MYCTU Enoyl-CoA hydratase EchA19 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA19 PE=1 SV=2
16	Q8BH95	3.62e-26	107	290	0.223	0.252	ECHM_MOUSE Enoyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Echs1 PE=1 SV=1
17	Q7JR58	7.11e-26	106	295	0.232	0.258	Q7JR58_DROME Enoyl-CoA hydratase, short chain 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Echs1 PE=1 SV=1
18	Q4WF54	7.63e-26	105	270	0.241	0.293	SIDH_ASPFU Mevalonyl-coenzyme A hydratase sidH OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sidH PE=1 SV=1
19	P14604	1.13e-25	105	290	0.220	0.248	ECHM_RAT Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Echs1 PE=1 SV=1
20	P34559	2.89e-25	104	288	0.213	0.243	ECHM_CAEEL Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ech-6 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00378 ECH_1	1.5e-45	167.1	Enoyl-CoA hydratase/isomerase
2	PF16113 ECH_2	2.8e-27	107.7	Enoyl-CoA hydratase/isomerase
3	PF09370 PEP_hydrolase	2.3e+02	12.4	Phosphoenolpyruvate hydrolase-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369461	0.993	Enoyl-CoA delta isomerase 2, mitochondrial
2	9606.ENSP00000420914	0.989	Peroxisomal multifunctional enzyme type 2
3	9606.ENSP00000265322	0.977	Peroxisomal trans-2-enoyl-CoA reductase
4	9606.ENSP00000307697	0.977	Peroxisomal acyl-coenzyme A oxidase 2
5	9606.ENSP00000293217	0.976	Peroxisomal acyl-coenzyme A oxidase 1
6	9606.ENSP00000360569	0.973	Non-specific lipid-transfer protein
7	9606.ENSP00000317721	0.971	Peroxisomal sarcosine oxidase
8	9606.ENSP00000315013	0.969	Carnitine O-acetyltransferase
9	9606.ENSP00000217455	0.967	Acyl-coenzyme A thioesterase 8
10	9606.ENSP00000219481	0.967	Peroxisomal 2,4-dienoyl-CoA reductase
11	9606.ENSP00000285737	0.967	Lon protease homolog 2, peroxisomal
12	9606.ENSP00000323071	0.966	Acyl-coenzyme A thioesterase 4
13	9606.ENSP00000323811	0.965	2-hydroxyacyl-CoA lyase 1
14	9606.ENSP00000326219	0.965	Dehydrogenase/reductase SDR family member 4
15	9606.ENSP00000348775	0.965	Peroxisomal acyl-coenzyme A oxidase 3
16	9606.ENSP00000355607	0.965	Glyceronephosphate O-acyltransferase
17	9606.ENSP00000483507	0.964	Hydroxyacid oxidase 2
18	9606.ENSP00000262430	0.963	Malonyl-CoA decarboxylase, mitochondrial
19	9606.ENSP00000368066	0.963	Hydroxyacid oxidase 1
20	9606.ENSP00000238651	0.954	Acyl-coenzyme A thioesterase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0005515	0.996	protein binding
GO:0016829	0.929	lyase activity
GO:0016836	0.425	hydro-lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:1901575	0.997	organic substance catabolic process
GO:0044248	0.996	cellular catabolic process
GO:0019752	0.995	carboxylic acid metabolic process
GO:0006629	0.993	lipid metabolic process
GO:0046395	0.993	carboxylic acid catabolic process
GO:0044255	0.984	cellular lipid metabolic process
GO:0016042	0.968	lipid catabolic process
GO:0006631	0.962	fatty acid metabolic process
GO:0009062	0.936	fatty acid catabolic process
GO:0019395	0.885	fatty acid oxidation
GO:0006635	0.656	fatty acid beta-oxidation
GO:0006807	0.540	nitrogen compound metabolic process
GO:1901564	0.457	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0005829	0.959	cytosol
GO:0005777	0.930	peroxisome
GO:0005739	0.927	mitochondrion
GO:0031907	0.846	microbody lumen
GO:0005782	0.716	peroxisomal matrix
GO:0016020	0.708	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.-.-.-	0.929	Lyases.
EC:4.2.1.-	0.425	Hydro-lyases.

[back to server]