StarFunc result for job id Q13015

User Input

>input (90 residues)
MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKN
PEGDGLLEYSTFNFWRAPIASIHSFELDLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13015	1.000	1.000	4.427E-14	90	1.000	1.000	Q13015.pdb.gz	AF1Q_HUMAN Protein AF1q OS=Homo sapiens OX=9606 GN=MLLT11 PE=1 SV=1
2	AFDB:P97783	0.424	0.424	2.611E-10	90	0.867	0.867	P97783.pdb.gz	AF1Q_MOUSE Protein AF1q OS=Mus musculus OX=10090 GN=Mllt11 PE=1 SV=1
3	AFDB:O96881	0.167	0.071	1.551	292	0.167	0.051	O96881.pdb.gz	O96881_DROME Transcription initiation factor IIE subunit beta OS=Drosophila melanogaster OX=7227 GN=TfIIEbeta PE=1 SV=1
4	AFDB:P14923	0.220	0.039	2.353	745	0.111	0.013	P14923.pdb.gz	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
5	AFDB:Q39096	0.121	0.080	2.522	163	0.144	0.080	Q39096.pdb.gz	ERD15_ARATH Protein EARLY RESPONSIVE TO DEHYDRATION 15 OS=Arabidopsis thaliana OX=3702 GN=ERD15 PE=1 SV=1
6	AFDB:A6NCL1	0.194	0.076	3.827	334	0.178	0.048	A6NCL1.pdb.gz	GEMC1_HUMAN Geminin coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GMNC PE=1 SV=2
7	AFDB:P61295	0.177	0.093	3.827	217	0.089	0.037	P61295.pdb.gz	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1
8	AFDB:E7FDS4	0.211	0.070	5.416	382	0.200	0.047	E7FDS4.pdb.gz	E7FDS4_DANRE Geminin coiled-coil domain-containing OS=Danio rerio OX=7955 GN=gmnc PE=4 SV=1
9	AFDB:A0JMK6	0.182	0.042	5.805	583	0.211	0.033	A0JMK6.pdb.gz	SCG2B_DANRE Secretogranin-2b OS=Danio rerio OX=7955 GN=scg2b PE=2 SV=1
10	AFDB:Q90WK1	0.212	0.122	6.223	194	0.133	0.062	Q90WK1.pdb.gz	Q90WK1_CHICK Platelet derived growth factor subunit A OS=Gallus gallus OX=9031 GN=PDGF-A (S2) PE=2 SV=1
11	PDB:4v8mA6	0.137	0.075	9.176	186	0.089	0.043	4v8mA6.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
12	PDB:5n9jS	0.124	0.069	9.836	171	0.067	0.035	5n9jS.pdb.gz
13	PDB:7lxdA	0.166	0.021	9.836	1190	0.178	0.013	7lxdA.pdb.gz	Cryo-EM reveals conformational flexibility in apo DNA polymerase zeta.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13015	1.56e-62	186	90	1.000	1.000	AF1Q_HUMAN Protein AF1q OS=Homo sapiens OX=9606 GN=MLLT11 PE=1 SV=1
2	Q6FGF7	1.56e-62	186	90	1.000	1.000	Q6FGF7_HUMAN Protein AF1q (Fragment) OS=Homo sapiens OX=9606 GN=AF1Q PE=2 SV=1
3	P97783	2.90e-49	152	90	0.867	0.867	AF1Q_MOUSE Protein AF1q OS=Mus musculus OX=10090 GN=Mllt11 PE=1 SV=1
4	A0A0B4JD31	0.016	35.0	992	0.144	0.013	A0A0B4JD31_DROME Lipin, isoform L OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
5	A0A0B4JD00	0.017	35.0	1034	0.144	0.013	A0A0B4JD00_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
6	A8DY69	0.017	35.0	1035	0.144	0.013	A8DY69_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
7	E5DK16	0.017	35.0	962	0.144	0.014	E5DK16_DROME Lipin isoform J OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
8	Q92539	0.046	33.9	896	0.133	0.013	LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX=9606 GN=LPIN2 PE=1 SV=1
9	Q8BW10	0.075	33.1	403	0.144	0.032	NOB1_MOUSE RNA-binding protein NOB1 OS=Mus musculus OX=10090 GN=Nob1 PE=1 SV=1
10	Q9ULX3	0.083	33.1	412	0.144	0.032	NOB1_HUMAN RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1
11	Q8TF05	0.11	32.7	950	0.156	0.015	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1
12	F1MRS1	0.16	32.3	893	0.122	0.012	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
13	Q9BQK8	0.62	30.4	851	0.122	0.013	LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens OX=9606 GN=LPIN3 PE=1 SV=3
14	P14713	1.5	29.3	1172	0.189	0.015	PHYB_ARATH Phytochrome B OS=Arabidopsis thaliana OX=3702 GN=PHYB PE=1 SV=1
15	P22567	1.7	29.3	432	0.178	0.037	ARGA_PSEAE Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=argA PE=1 SV=2
16	D3ZP96	2.0	28.9	905	0.133	0.013	D3ZP96_RAT DNA replication licensing factor MCM2 OS=Rattus norvegicus OX=10116 GN=Mcm2 PE=1 SV=2
17	P97310	2.0	28.9	904	0.133	0.013	MCM2_MOUSE DNA replication licensing factor MCM2 OS=Mus musculus OX=10090 GN=Mcm2 PE=1 SV=3
18	D3ZE55	3.7	28.5	1069	0.167	0.014	PCDH8_RAT Protocadherin-8 OS=Rattus norvegicus OX=10116 GN=Pcdh8 PE=1 SV=2
19	Q7TSK3	3.7	28.5	1070	0.167	0.014	PCDH8_MOUSE Protocadherin-8 OS=Mus musculus OX=10090 GN=Pcdh8 PE=1 SV=1
20	Q9NXV6	4.7	28.1	580	0.178	0.028	CARF_HUMAN CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15017 WRNPLPNID	2e-22	91.1	Putative WW-binding domain and destruction box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357917

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340347	0.898	Transcription factor 7
2	9606.ENSP00000436786	0.736	Histone-lysine N-methyltransferase 2A
3	9606.ENSP00000479910	0.618	Protein AF-17
4	9606.ENSP00000366939	0.589	Mitochondrial genome maintenance exonuclease 1
5	9606.ENSP00000294117	0.566	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
6	9606.ENSP00000307411	0.564	Protein AF-10
7	9606.ENSP00000262809	0.563	RNA polymerase II elongation factor ELL
8	9606.ENSP00000252674	0.562	Protein ENL
9	9606.ENSP00000265165	0.539	Lymphoid enhancer-binding factor 1
10	9606.ENSP00000369695	0.529	Protein AF-9
11	9606.ENSP00000378578	0.505	AF4/FMR2 family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.386	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0019222	0.987	regulation of metabolic process
GO:0050896	0.984	response to stimulus
GO:0031323	0.984	regulation of cellular metabolic process
GO:0048522	0.981	positive regulation of cellular process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0009889	0.977	regulation of biosynthetic process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0051252	0.972	regulation of RNA metabolic process
GO:0051716	0.970	cellular response to stimulus
GO:0031325	0.969	positive regulation of cellular metabolic process
GO:0031326	0.963	regulation of cellular biosynthetic process
GO:0033043	0.962	regulation of organelle organization
GO:0023052	0.960	signaling
GO:0010556	0.959	regulation of macromolecule biosynthetic process
GO:0010468	0.958	regulation of gene expression
GO:0007154	0.956	cell communication
GO:0051173	0.951	positive regulation of nitrogen compound metabolic process
GO:0007165	0.922	signal transduction
GO:0042391	0.911	regulation of membrane potential
GO:0010821	0.900	regulation of mitochondrion organization
GO:0006355	0.897	regulation of DNA-templated transcription
GO:0051881	0.896	regulation of mitochondrial membrane potential
GO:0006915	0.891	apoptotic process
GO:0010638	0.886	positive regulation of organelle organization
GO:0010604	0.878	positive regulation of macromolecule metabolic process
GO:0045935	0.877	positive regulation of nucleobase-containing compound metabolic process
GO:0090199	0.875	regulation of release of cytochrome c from mitochondria
GO:0035556	0.813	intracellular signal transduction
GO:0097190	0.804	apoptotic signaling pathway
GO:0007166	0.797	cell surface receptor signaling pathway
GO:0097191	0.783	extrinsic apoptotic signaling pathway
GO:0003254	0.753	regulation of membrane depolarization
GO:0010822	0.748	positive regulation of mitochondrion organization
GO:0051254	0.740	positive regulation of RNA metabolic process
GO:0009891	0.736	positive regulation of biosynthetic process
GO:0045893	0.693	positive regulation of DNA-templated transcription
GO:0097193	0.580	intrinsic apoptotic signaling pathway
GO:0043067	0.501	regulation of programmed cell death
GO:0042981	0.488	regulation of apoptotic process
GO:0010942	0.366	positive regulation of cell death
GO:0043065	0.364	positive regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]