StarFunc result for job id Q13017

User Input

>input (1502 residues)
MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ASKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFV
NNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFT
ALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPNLEEIEHLN
WSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAAFKPHGCFC
VFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQ
LANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPANKDLSEADLRI
VMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQ
SEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYP
IHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLA
HPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIKIRNSFVNNTQGDEENGFSDR
TSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINL
VSMEVTVNAVAGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPV
NYDVFRYVITHLNRVSQQHKINLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVET
FIQQCQFFFYNGEIVETTNIVAPPPPSNPGQLVEPMVPLQLPPPLQPQLIQPQLQTDPLG
II

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P81128	0.435	0.436	0.000	1499	0.506	0.507	P81128.pdb.gz	RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus OX=10116 GN=Arhgap35 PE=1 SV=3
2	AFDB:P97393	0.740	0.741	0.000	1501	0.945	0.946	P97393.pdb.gz	RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus OX=10090 GN=Arhgap5 PE=1 SV=3
3	AFDB:Q9VX32	0.377	0.366	3.757E-97	1561	0.290	0.279	Q9VX32.pdb.gz	RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster OX=7227 GN=RhoGAPp190 PE=1 SV=2
4	PDB:3cxlA	0.126	0.458	3.274E-12	402	0.051	0.189	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
5	PDB:1xa6A	0.124	0.458	1.275E-11	399	0.045	0.170	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
6	PDB:6r3vA	0.121	0.858	5.209E-11	198	0.032	0.242	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
7	PDB:5jcpA	0.118	0.476	1.028E-10	361	0.036	0.150	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
8	AFDB:E7F3F0	0.125	0.084	7.127E-10	2286	0.113	0.074	E7F3F0.pdb.gz	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
9	PDB:5c2kA	0.119	0.442	2.657E-9	382	0.050	0.196	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
10	AFDB:A6X8Z5	0.127	0.134	8.124E-7	1425	0.045	0.048	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
11	AFDB:Q9V9S7	0.120	0.097	9.865E-7	1866	0.068	0.055	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
12	PDB:5szjA	0.099	0.698	1.611E-6	175	0.027	0.229	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:5sziA	0.097	0.723	5.423E-6	174	0.025	0.218	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:5szhB	0.101	0.758	6.273E-6	175	0.024	0.206	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:7sd0B	0.099	0.682	6.585E-6	174	0.030	0.259	7sd0B.pdb.gz	Structural basis for SHOC2 modulation of RAS signalling.
16	PDB:2f9mA	0.099	0.728	1.123E-5	182	0.028	0.231	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
17	AFDB:Q8N264	0.124	0.247	1.648E-5	748	0.045	0.091	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
18	AFDB:X2JC00	0.121	0.130	2.550E-5	1404	0.033	0.035	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
19	AFDB:D4A9G6	0.123	0.141	3.947E-5	1310	0.044	0.050	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
20	AFDB:A0A1D8PRQ6	0.122	0.125	5.064E-3	1468	0.079	0.080	A0A1D8PRQ6.pdb.gz	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K7N9	0.0	3039	1502	0.973	0.973	A0A0G2K7N9_RAT Rho GTPase activating protein 5 OS=Rattus norvegicus OX=10116 GN=Arhgap5 PE=1 SV=2
2	P81128	0.0	1460	1499	0.506	0.507	RHG35_RAT Rho GTPase-activating protein 35 OS=Rattus norvegicus OX=10116 GN=Arhgap35 PE=1 SV=3
3	P97393	0.0	3058	1503	0.974	0.973	RHG05_MOUSE Rho GTPase-activating protein 5 OS=Mus musculus OX=10090 GN=Arhgap5 PE=1 SV=3
4	Q13017	0.0	3127	1502	1.000	1.000	RHG05_HUMAN Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5 PE=1 SV=2
5	Q6TUE6	0.0	2512	1245	0.803	0.969	Q6TUE6_RAT LRRGT00098 OS=Rattus norvegicus OX=10116 GN=Arhgap5 PE=1 SV=1
6	Q91YM2	0.0	1456	1499	0.502	0.503	RHG35_MOUSE Rho GTPase-activating protein 35 OS=Mus musculus OX=10090 GN=Arhgap35 PE=1 SV=3
7	Q9NRY4	0.0	1454	1499	0.505	0.506	RHG35_HUMAN Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3
8	Q9VX32	1.60e-174	566	1561	0.212	0.204	RG190_DROME Rho GTPase-activating protein 190 OS=Drosophila melanogaster OX=7227 GN=RhoGAPp190 PE=1 SV=2
9	Q7ZUT6	1.30e-33	138	459	0.049	0.159	Q7ZUT6_DANRE Chimerin (Chimaerin) 1 OS=Danio rerio OX=7955 GN=chimaerin PE=1 SV=1
10	P30337	3.52e-32	131	334	0.047	0.210	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
11	P15882	4.37e-31	130	459	0.047	0.155	CHIN_HUMAN N-chimaerin OS=Homo sapiens OX=9606 GN=CHN1 PE=1 SV=3
12	Q91V57	4.66e-31	130	459	0.047	0.153	CHIN_MOUSE N-chimaerin OS=Mus musculus OX=10090 GN=Chn1 PE=1 SV=2
13	Q03070	1.52e-30	125	295	0.042	0.214	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1
14	Q6TLK4	1.39e-29	130	869	0.045	0.077	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
15	P52757	5.03e-29	125	468	0.064	0.205	CHIO_HUMAN Beta-chimaerin OS=Homo sapiens OX=9606 GN=CHN2 PE=1 SV=2
16	Q6ZUM4	7.52e-28	124	889	0.043	0.073	RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
17	Q53QZ3	7.71e-27	118	475	0.041	0.131	RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2
18	E7F3F0	2.27e-23	110	2286	0.042	0.028	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
19	Q99N37	8.60e-23	108	858	0.044	0.077	RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus OX=10116 GN=Arhgap17 PE=1 SV=1
20	Q3UIA2	9.28e-23	108	846	0.044	0.078	RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus OX=10090 GN=Arhgap17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01846 FF	1.1e-10	52.9	FF domain
2	PF00009 GTP_EFTU	57	14.7	Elongation factor Tu GTP binding domain
3	PF18796 LPD1	2.2e+02	13.4	Large polyvalent protein-associated domain 1
4	PF01926 MMR_HSR1	1.4e+02	14.0	50S ribosome-binding GTPase
5	PF06858 NOG1	68	14.6	Nucleolar GTP-binding protein 1 (NOG1)
6	PF00071 Ras	1.7e-10	52.2	Ras family
7	PF00620 RhoGAP	6.5e-44	160.8	RhoGAP domain
8	PF16512 RhoGAP-FF1	8.6e-26	101.7	p190-A and -B Rho GAPs FF domain
9	PF19518 RhoGAP_pG1_pG2	0	1049.4	p190RhoGAP, pG1 and pG2 domains
10	PF08477 Roc	1.1e+02	14.4	Ras of Complex, Roc, domain of DAPkinase
11	PF10597 U5_2-snRNA_bdg	2.9e+02	13.0	U5-snRNA binding site 2 of PrP8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371897

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.991	Transforming protein RhoA
2	9606.ENSP00000362680	0.967	Proto-oncogene tyrosine-protein kinase Src
3	9606.ENSP00000382697	0.951	Rho-associated protein kinase 1
4	9606.ENSP00000348461	0.938	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000056217	0.935	Rho guanine nucleotide exchange factor 5
6	9606.ENSP00000337261	0.933	Rho guanine nucleotide exchange factor 1
7	9606.ENSP00000343325	0.923	Serine/threonine-protein kinase N1
8	9606.ENSP00000407586	0.920	GTPase HRas
9	9606.ENSP00000364886	0.918	Rho-related GTP-binding protein RhoE
10	9606.ENSP00000472929	0.918	Proto-oncogene vav
11	9606.ENSP00000440005	0.907	ADP-ribosylation factor 1
12	9606.ENSP00000339299	0.905	Triple functional domain protein
13	9606.ENSP00000353362	0.904	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
14	9606.ENSP00000242285	0.902	Clathrin light chain A
15	9606.ENSP00000258739	0.902	ER lumen protein-retaining receptor 2
16	9606.ENSP00000309415	0.902	Clathrin light chain B
17	9606.ENSP00000329471	0.902	ER lumen protein-retaining receptor 1
18	9606.ENSP00000386918	0.902	ER lumen protein-retaining receptor 3
19	9606.ENSP00000357048	0.900	Coatomer subunit alpha
20	9606.ENSP00000382004	0.815	Catenin delta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0016817	0.998	hydrolase activity, acting on acid anhydrides
GO:0003924	0.908	GTPase activity
GO:0019904	0.780	protein domain specific binding
GO:0042169	0.611	SH2 domain binding
GO:0019899	0.547	enzyme binding
GO:0044877	0.451	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0032502	0.941	developmental process
GO:0048856	0.899	anatomical structure development
GO:0030879	0.840	mammary gland development
GO:0050896	0.788	response to stimulus
GO:0048583	0.780	regulation of response to stimulus
GO:0023051	0.779	regulation of signaling
GO:0010646	0.777	regulation of cell communication
GO:0009966	0.770	regulation of signal transduction
GO:0051716	0.717	cellular response to stimulus
GO:0048522	0.676	positive regulation of cellular process
GO:1902531	0.621	regulation of intracellular signal transduction
GO:0071840	0.601	cellular component organization or biogenesis
GO:0016043	0.584	cellular component organization
GO:0032501	0.560	multicellular organismal process
GO:0007165	0.558	signal transduction
GO:0051056	0.548	regulation of small GTPase mediated signal transduction
GO:0030334	0.434	regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005783	0.650	endoplasmic reticulum
GO:0005886	0.363	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.-.-	0.998	Acting on acid anhydrides.
RHEA:19669	0.908	GTP + H2O = GDP + H(+) + phosphate

[back to server]