StarFunc result for job id Q13018

User Input

>input (1463 residues)
MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLT
LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRK
MITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMF
PFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
ICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTVEVWMGLNQLDEH
AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYLNH
IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVS
AEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
SGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEP
VQYTHWNTHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWP
FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNE
LLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGEDARNCAVYKAN
KTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWD
TGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPK
GWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTS
VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIK
TCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
EESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
GNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFICKME
ADIHTAEALPEKGPSHSIIPLAVVLTLIVIVAICTLSFCIYKHNGGFFRRLAGFRNPYYP
ATNFSTVYLEENILISDLEKSDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7jptA	0.545	0.594	0.000	1327	0.319	0.351	7jptA.pdb.gz
2	PDB:7qsrA	0.622	0.674	0.000	1335	0.912	0.999	7qsrA.pdb.gz
3	AFDB:O60449	0.544	0.469	0.000	1722	0.332	0.282	O60449.pdb.gz	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
4	AFDB:P22897	0.468	0.470	0.000	1456	0.289	0.291	P22897.pdb.gz	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
5	AFDB:Q13018	1.000	1.000	0.000	1463	1.000	1.000	Q13018.pdb.gz	PLA2R_HUMAN Secretory phospholipase A2 receptor OS=Homo sapiens OX=9606 GN=PLA2R1 PE=1 SV=2
6	AFDB:Q4TU93	0.560	0.554	0.000	1480	0.344	0.340	Q4TU93.pdb.gz	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
7	AFDB:Q60767	0.557	0.482	0.000	1723	0.328	0.279	Q60767.pdb.gz	LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 GN=Ly75 PE=1 SV=2
8	AFDB:Q61830	0.468	0.470	0.000	1456	0.283	0.284	Q61830.pdb.gz	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
9	AFDB:Q62028	0.745	0.734	0.000	1487	0.733	0.721	Q62028.pdb.gz	PLA2R_MOUSE Secretory phospholipase A2 receptor OS=Mus musculus OX=10090 GN=Pla2r1 PE=1 SV=1
10	AFDB:Q17452	0.084	0.377	4.958E-16	308	0.045	0.214	Q17452.pdb.gz	Q17452_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-52 PE=1 SV=1
11	AFDB:P90732	0.083	0.214	3.397E-15	545	0.059	0.160	P90732.pdb.gz	P90732_CAEEL Cubilin OS=Caenorhabditis elegans OX=6239 GN=clec-41 PE=1 SV=1
12	AFDB:Q9XUA7	0.100	0.416	5.151E-15	295	0.040	0.200	Q9XUA7.pdb.gz	Q9XUA7_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-187 PE=1 SV=1
13	PDB:1qddA	0.084	0.809	5.869E-9	144	0.027	0.271	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
14	PDB:4mthA	0.085	0.807	6.098E-8	139	0.027	0.288	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
15	PDB:7wz8A	0.080	0.610	1.726E-7	180	0.025	0.200	7wz8A.pdb.gz
16	PDB:5f2qB	0.085	0.857	1.915E-7	135	0.025	0.267	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
17	PDB:1gz2A	0.082	0.782	2.125E-7	139	0.025	0.266	1gz2A.pdb.gz
18	PDB:1htnA	0.078	0.662	4.637E-7	156	0.021	0.199	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
19	PDB:3bx4C	0.068	0.664	9.118E-7	134	0.028	0.306	3bx4C.pdb.gz
20	PDB:1bj3B	0.069	0.763	1.793E-6	123	0.021	0.252	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60449	0.0	763	1722	0.332	0.282	LY75_HUMAN Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3
2	P22897	0.0	586	1456	0.286	0.288	MRC1_HUMAN Macrophage mannose receptor 1 OS=Homo sapiens OX=9606 GN=MRC1 PE=1 SV=1
3	Q13018	0.0	3055	1463	1.000	1.000	PLA2R_HUMAN Secretory phospholipase A2 receptor OS=Homo sapiens OX=9606 GN=PLA2R1 PE=1 SV=2
4	Q4LDF5	0.0	813	1732	0.340	0.287	Q4LDF5_CHICK DEC-205 protein OS=Gallus gallus OX=9031 GN=DEC205 PE=2 SV=1
5	Q4TU93	0.0	846	1480	0.351	0.347	MRC2_RAT C-type mannose receptor 2 OS=Rattus norvegicus OX=10116 GN=Mrc2 PE=1 SV=1
6	Q60767	0.0	738	1723	0.327	0.277	LY75_MOUSE Lymphocyte antigen 75 OS=Mus musculus OX=10090 GN=Ly75 PE=1 SV=2
7	Q62028	0.0	2267	1487	0.734	0.722	PLA2R_MOUSE Secretory phospholipase A2 receptor OS=Mus musculus OX=10090 GN=Pla2r1 PE=1 SV=1
8	Q64449	0.0	849	1479	0.355	0.351	MRC2_MOUSE C-type mannose receptor 2 OS=Mus musculus OX=10090 GN=Mrc2 PE=1 SV=3
9	Q9UBG0	0.0	847	1479	0.355	0.352	MRC2_HUMAN C-type mannose receptor 2 OS=Homo sapiens OX=9606 GN=MRC2 PE=1 SV=2
10	Q61830	7.95e-177	569	1456	0.280	0.282	MRC1_MOUSE Macrophage mannose receptor 1 OS=Mus musculus OX=10090 GN=Mrc1 PE=1 SV=2
11	Q90611	9.98e-14	78.6	663	0.022	0.048	MMP2_CHICK 72 kDa type IV collagenase OS=Gallus gallus OX=9031 GN=MMP2 PE=1 SV=1
12	P33434	6.18e-13	75.9	662	0.021	0.047	MMP2_MOUSE 72 kDa type IV collagenase OS=Mus musculus OX=10090 GN=Mmp2 PE=1 SV=1
13	P08253	6.83e-13	75.9	660	0.021	0.047	MMP2_HUMAN 72 kDa type IV collagenase OS=Homo sapiens OX=9606 GN=MMP2 PE=1 SV=2
14	P33436	8.41e-13	75.5	662	0.021	0.047	MMP2_RAT 72 kDa type IV collagenase OS=Rattus norvegicus OX=10116 GN=Mmp2 PE=1 SV=2
15	Q7T317	1.44e-12	74.7	680	0.021	0.046	Q7T317_DANRE Matrix metalloproteinase 9 OS=Danio rerio OX=7955 GN=wu:fi98c09 PE=2 SV=1
16	Q17452	1.51e-12	72.4	308	0.044	0.208	Q17452_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-52 PE=1 SV=1
17	Q08731	2.56e-12	68.9	173	0.034	0.289	LIT2_MOUSE Lithostathine-2 OS=Mus musculus OX=10090 GN=Reg2 PE=1 SV=1
18	Q9Z2G6	2.88e-12	73.9	790	0.022	0.041	SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus OX=10090 GN=Sel1l PE=1 SV=2
19	Q9UBV2	3.04e-12	73.9	794	0.021	0.039	SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3
20	P20693	1.02e-11	70.5	331	0.027	0.121	FCER2_MOUSE Low affinity immunoglobulin epsilon Fc receptor OS=Mus musculus OX=10090 GN=Fcer2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	1.5	19.6	Chordopoxvirus A33R protein
2	PF00040 fn2	3.8e-14	63.8	Fibronectin type II domain
3	PF00059 Lectin_C	2.7e-124	419.1	Lectin C-type domain
4	PF05473 UL45	2.6e-08	45.3	UL45 protein, carbohydrate-binding C-type lectin-like
5	PF00193 Xlink	0.1	24.2	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000393847	0.990	Group 10 secretory phospholipase A2
2	9606.ENSP00000383364	0.982	Phospholipase A2, membrane associated
3	9606.ENSP00000364246	0.979	Group IID secretory phospholipase A2
4	9606.ENSP00000406482	0.919	Thrombospondin type-1 domain-containing protein 7A
5	9606.ENSP00000312286	0.903	Phospholipase A2
6	9606.ENSP00000455897	0.823	Macrophage mannose receptor 1
7	9606.ENSP00000307513	0.815	C-type mannose receptor 2
8	9606.ENSP00000364249	0.748	Calcium-dependent phospholipase A2
9	9606.ENSP00000339398	0.721	Major histocompatibility complex, class II, DQ alpha 1
10	9606.ENSP00000364076	0.681	HLA class II histocompatibility antigen, DQ alpha 2 chain
11	9606.ENSP00000363079	0.672	Mannose-binding protein C
12	9606.ENSP00000312277	0.664	Zinc finger protein 507
13	9606.ENSP00000270625	0.652	Ribosomal protein S11
14	9606.ENSP00000378868	0.642	APOBEC1 complementation factor
15	9606.ENSP00000367747	0.621	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
16	9606.ENSP00000479636	0.619	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
17	9606.ENSP00000295897	0.601	Serum albumin
18	9606.ENSP00000285930	0.599	Aldose reductase
19	9606.ENSP00000379377	0.567	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
20	9606.ENSP00000266505	0.565	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043274	1.000	phospholipase binding
GO:0038023	0.999	signaling receptor activity
GO:0044877	0.321	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.990	cellular process
GO:0050896	0.969	response to stimulus
GO:0050794	0.969	regulation of cellular process
GO:0051179	0.964	localization
GO:0008152	0.955	metabolic process
GO:0048583	0.925	regulation of response to stimulus
GO:0006950	0.911	response to stress
GO:0048518	0.902	positive regulation of biological process
GO:0044237	0.884	cellular metabolic process
GO:0051716	0.865	cellular response to stimulus
GO:0023051	0.858	regulation of signaling
GO:0010646	0.858	regulation of cell communication
GO:0006810	0.857	transport
GO:0009966	0.829	regulation of signal transduction
GO:0048522	0.816	positive regulation of cellular process
GO:0016192	0.748	vesicle-mediated transport
GO:1902531	0.657	regulation of intracellular signal transduction
GO:0042221	0.652	response to chemical
GO:0048584	0.604	positive regulation of response to stimulus
GO:0071704	0.572	organic substance metabolic process
GO:0080134	0.559	regulation of response to stress
GO:0019222	0.543	regulation of metabolic process
GO:0051239	0.516	regulation of multicellular organismal process
GO:0060255	0.507	regulation of macromolecule metabolic process
GO:0070887	0.457	cellular response to chemical stimulus
GO:0006897	0.445	endocytosis
GO:0010468	0.443	regulation of gene expression
GO:0006898	0.441	receptor-mediated endocytosis
GO:1901796	0.431	regulation of signal transduction by p53 class mediator
GO:0010941	0.419	regulation of cell death
GO:0032501	0.416	multicellular organismal process
GO:0044238	0.370	primary metabolic process
GO:0048519	0.324	negative regulation of biological process
GO:0009967	0.319	positive regulation of signal transduction
GO:0033554	0.303	cellular response to stress
GO:0042981	0.301	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.997	cell periphery
GO:0005886	0.990	plasma membrane
GO:0032991	0.972	protein-containing complex
GO:0005576	0.937	extracellular region
GO:0005622	0.746	intracellular anatomical structure
GO:0043226	0.698	organelle
GO:0005737	0.691	cytoplasm
GO:0043227	0.690	membrane-bounded organelle
GO:0009986	0.680	cell surface
GO:0043229	0.625	intracellular organelle
GO:0043235	0.579	receptor complex
GO:0043231	0.553	intracellular membrane-bounded organelle
GO:0005615	0.340	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]