StarFunc result for job id Q13023

User Input

>input (2319 residues)
MLTMSVTLSPLRSQDLDPMATDASPMAINMTPTVEQGEGEEAMKDMDSDQQYEKPPPLHT
GADWKIVLHLPEIETWLRMTSERVRDLTYSVQQDSDSKHVDVHLVQLKDICEDISDHVEQ
IHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQT
DILQAFSEETKEGRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLSGL
GDMTSSQVKTKPFDSWSYSEMEKEFPELIRSVGLLTVAADSISTNGSEAVTEEVSQVSLS
VDDKGGCEEDNASAVEEQPGLTLGVSSSSGEALTNAAQPSSETVQQESSSSSHHDAKNQQ
PVPCENATPKRTIRDCFNYNEDSPTQPTLPKRGLFLKEETFKNDLKGNGGKRQMVDLKPE
MSRSTPSLVDPPDRSKLCLVLQSSYPNSPSAASQSYECLHKVGNGNLENTVKFHIKEISS
SLGRLNDCYKEKSRLKKPHKTSEEVPPCRTPKRGTGSGKQAKNTKSSAVPNGELSYTSKA
IEGPQTNSASTSSLEPCNQRSWNAKLQLQSETSSSPAFTQSSESSVGSDNIMSPVPLLSK
HKSKKGQASSPSHVTRNGEVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRG
ETIQNIDDWELSEMNSDSEIYPTYHVKKKHTRLGRVSPSSSSDIASSLGESIESGPLSDI
LSDEESSMPLAGMKKYADEKSERASSSEKNESHSATKSALIQKLMQDIQHQDNYEAIWEK
IEGFVNKLDEFIQWLNEAMETTENWTPPKAEMDDLKLYLETHLSFKLNVDSHCALKEAVE
EEGHQLLELIASHKAGLKDMLRMIASQWKELQRQIKRQHSWILRALDTIKAEILATDVSV
EDEEGTGSPKAEVQLCYLEAQRDAVEQMSLKLYSEQYTSSSKRKEEFADMSKVHSVGSNG
LLDFDSEYQELWDWLIDMESLVMDSHDLMMSEEQQQHLYKRYSVEMSIRHLKKTELLSKV
EALKKGGVLLPNDLLEKVDSINEKWELLGKTLGEKIQDTMAGHSGSSPRDLLSPESGSLV
RQLEVRIKELKGWLRDTELFIFNSCLRQEKEGTMNTEKQLQYFKSLCREIKQRRRGVASI
LRLCQHLLDDRETCNLNADHQPMQLIIVNLERRWEAIVMQAVQWQTRLQKKMGKESETLN
VIDPGLMDLNGMSEDALEWDEMDISNKLISLNEESNDLDQELQPVIPSLKLGETSNEDPG
YDEEADNHGGSQYASNITAPSSPHIYQVYSLHNVELYEDNHMPFLKNNPKVTGMTQPNVL
TKSLSKDSSFSSTKSLPDLLGGSNLVKPCACHGGDMSQNSGSESGIVSEGDTETTTNSEM
CLLNAVDGSPSNLETEHLDPQMGDAVNVLKQKFTDEGESIKLPNSSQSSISPVGCVNGKV
GDLNSITKHTPDCLGEELQGKHDVFTFYDYSYLQGSKLKLPMIMKQSQSEKAHVEDPLLR
GFYFDKKSCKSKHQTTELQPDVPPHERILASASHEMDRISYKSGNIEKTFTGMQNAKQLS
LLSHSSSIESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISV
SSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQKMSFTGQMSLDIASSI
NEDSAASLTELSSSDELSLCSEDIVLHKNKIPESNASFRKRLTRSVADESDVNVSMIVNV
SCTSACTDDEDDSDLLSSSTLTLTEEELCIKDEDDDSSIATDDEIYEDCTLMSGLDYIKN
ELQTWIRPKLSLTRDKKRCNVSDEMKGSKDISSSEMTNPSDTLNIETLLNGSVKRVSENN
GNGKNSSHTHELGTKRENKKTIFKVNKDPYVADMENGNIEGIPERQKGKPNVTSKVSENL
GSHGKEISESEHCKCKALMDSLDDSNTAGKEFVSQDVRHLPKKCPNHHHFENQSTASTPT
EKSFSELALETRFNNRQDSDALKSSDDAPSMAGKSAGCCLALEQNGTEENASISNISCCN
CEPDVFHQKDAEDCSVHNFVKEIIDMASTALKSKSQPENEVAAPTSLTQIKEKVLEHSHR
PIQLRKGDFYSYLSLSSHDSDCGEVTNYIEEKSSTPLPLDTTDSGLDDKEDIECFFEACV
EGDSDGEEPCFSSAPPNESAVPSEAAMPLQATACSSEFSDSSLSADDADTVALSSPSSQE
RAEVGKEVNGLPQTSSGCAENLEFTPSKLDSEKESSGKPGESGMPEEHNAASAKSKVQDL
SLKANQPTDKAALHPSPKTLTCEENLLNLHEKRHRNMHR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13023	0.999	0.999	0.000	2319	1.000	1.000	Q13023.pdb.gz	AKAP6_HUMAN A-kinase anchor protein 6 OS=Homo sapiens OX=9606 GN=AKAP6 PE=1 SV=3
2	AFDB:Q9WVC7	0.282	0.283	0.000	2314	0.795	0.797	Q9WVC7.pdb.gz	AKAP6_RAT A-kinase anchor protein 6 OS=Rattus norvegicus OX=10116 GN=Akap6 PE=1 SV=1
3	AFDB:Q6P5H2	0.043	0.044	3.240E-10	1864	0.126	0.157	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
4	AFDB:P21263	0.035	0.040	9.796E-8	1893	0.120	0.147	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
5	AFDB:Q9VUQ9	0.042	0.044	1.031E-7	2139	0.120	0.130	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
6	AFDB:Q54DW1	0.050	0.061	4.299E-7	1736	0.094	0.126	Q54DW1.pdb.gz	Q54DW1_DICDI DOCK family protein OS=Dictyostelium discoideum OX=44689 GN=docC PE=3 SV=1
7	AFDB:P35658	0.027	0.029	4.524E-7	2090	0.116	0.129	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
8	AFDB:O96124	0.039	0.038	1.192E-6	2441	0.147	0.140	O96124.pdb.gz	O96124_PLAF7 Erythrocyte membrane protein 3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0201900 PE=4 SV=1
9	AFDB:Q80U93	0.033	0.035	2.837E-6	2085	0.113	0.126	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
10	AFDB:Q5VUA4	0.027	0.028	7.475E-6	2279	0.125	0.128	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
11	PDB:4d1eA	0.053	0.121	1.145E-2	859	0.028	0.077	4d1eA.pdb.gz
12	PDB:7pksh	0.046	0.083	1.893E-1	887	0.024	0.062	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
13	PDB:5udkA	0.033	0.102	2.096E-1	461	0.024	0.119	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
14	PDB:7wooD	0.044	0.062	4.280E-1	1398	0.024	0.040	7wooD.pdb.gz
15	PDB:6qnxA	0.044	0.074	4.504E-1	928	0.031	0.079	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
16	PDB:6fyxo	0.033	0.086	5.523E-1	529	0.025	0.112	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
17	PDB:4horA	0.037	0.109	5.812E-1	482	0.029	0.139	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
18	PDB:7usdA	0.057	0.092	6.436E-1	1185	0.032	0.062	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
19	PDB:3c98B	0.056	0.393	8.740E-1	230	0.012	0.122	3c98B.pdb.gz
20	PDB:4pw8F	0.046	0.227	8.740E-1	303	0.013	0.096	4pw8F.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q9K8	0.0	3517	2307	0.806	0.810	E9Q9K8_MOUSE A kinase (PRKA) anchor protein 6 OS=Mus musculus OX=10090 GN=Akap6 PE=1 SV=1
2	Q13023	0.0	4761	2319	1.000	1.000	AKAP6_HUMAN A-kinase anchor protein 6 OS=Homo sapiens OX=9606 GN=AKAP6 PE=1 SV=3
3	Q2VEB3	0.0	3058	2064	0.707	0.795	Q2VEB3_MOUSE A-kinase anchoring protein beta OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1
4	Q2VEB4	0.0	3506	2308	0.805	0.809	Q2VEB4_MOUSE A-kinase anchoring protein alpha OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1
5	Q3TRB0	0.0	1099	701	0.253	0.837	Q3TRB0_MOUSE A-kinase anchor protein 6 (Fragment) OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1
6	Q3UHI8	0.0	3516	2307	0.806	0.810	Q3UHI8_MOUSE A-kinase anchor protein 6 OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1
7	Q3UHR2	0.0	3513	2307	0.805	0.809	Q3UHR2_MOUSE A-kinase anchor protein 6 OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1
8	Q6PGB9	0.0	1974	1224	0.442	0.838	Q6PGB9_MOUSE A kinase (PRKA) anchor protein 6 OS=Mus musculus OX=10090 GN=Akap6 PE=1 SV=1
9	Q6ZQD9	0.0	1084	824	0.265	0.746	Q6ZQD9_MOUSE MKIAA0311 protein (Fragment) OS=Mus musculus OX=10090 GN=Akap6 PE=2 SV=1
10	Q9WVC7	0.0	3467	2314	0.796	0.798	AKAP6_RAT A-kinase anchor protein 6 OS=Rattus norvegicus OX=10116 GN=Akap6 PE=1 SV=1
11	A0A0C4DG40	9.50e-12	73.9	8749	0.034	0.009	A0A0C4DG40_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
12	Q8NF91	1.07e-11	73.6	8797	0.034	0.009	SYNE1_HUMAN Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4
13	H0Y325	2.37e-11	72.4	1654	0.034	0.047	H0Y325_HUMAN Spectrin repeat containing nuclear envelope protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
14	H0Y326	4.53e-11	71.2	1355	0.034	0.058	H0Y326_HUMAN Spectrin repeat containing nuclear envelope protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
15	Q6ZWR6	1.22e-10	70.1	8799	0.027	0.007	SYNE1_MOUSE Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2
16	A0A5P8DHN0	1.23e-10	70.1	8815	0.027	0.007	A0A5P8DHN0_RAT Nesprin 1 long isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
17	A0A8I5ZJB9	1.24e-10	70.1	8815	0.027	0.007	A0A8I5ZJB9_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
18	A0A8I6ABC0	1.30e-10	70.1	8788	0.027	0.007	A0A8I6ABC0_RAT Spectrin repeat containing, nuclear envelope 1 OS=Rattus norvegicus OX=10116 GN=Syne1 PE=1 SV=1
19	A0A5P8DHK4	1.34e-10	70.1	8697	0.027	0.007	A0A5P8DHK4_RAT Nesprin 1 short isoform OS=Rattus norvegicus OX=10116 GN=Syne1 PE=2 SV=1
20	Q6ZWQ0	3.15e-10	68.6	6874	0.035	0.012	SYNE2_MOUSE Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03770 IPK	6.1e+02	11.6	Inositol polyphosphate kinase
2	PF00435 Spectrin	2.8e-05	35.9	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355533	0.991	Ryanodine receptor 2
2	9606.ENSP00000395708	0.988	Rap guanine nucleotide exchange factor 3
3	9606.ENSP00000419361	0.947	Adenylate cyclase type 5
4	9606.ENSP00000377036	0.921	Serine/threonine-protein phosphatase 2A activator
5	9606.ENSP00000370078	0.904	cAMP-specific 3',5'-cyclic phosphodiesterase 4A
6	9606.ENSP00000311005	0.891	Mitogen-activated protein kinase 7
7	9606.ENSP00000387123	0.882	Alpha-aminoadipic semialdehyde dehydrogenase
8	9606.ENSP00000378306	0.848	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
9	9606.ENSP00000380271	0.846	Rap guanine nucleotide exchange factor 4
10	9606.ENSP00000405252	0.811	A-kinase anchor protein 7 isoform gamma
11	9606.ENSP00000370373	0.802	Peptidyl-prolyl cis-trans isomerase FKBP1B
12	9606.ENSP00000354718	0.786	A-kinase anchor protein 13
13	9606.ENSP00000478212	0.766	A-kinase anchor protein 1, mitochondrial
14	9606.ENSP00000378207	0.756	A-kinase anchor protein 5
15	9606.ENSP00000345502	0.753	cAMP-specific 3',5'-cyclic phosphodiesterase 4D
16	9606.ENSP00000348573	0.745	A-kinase anchor protein 9
17	9606.ENSP00000427015	0.745	Ribosomal protein S6 kinase alpha-2
18	9606.ENSP00000271555	0.738	Myocyte-specific enhancer factor 2D
19	9606.ENSP00000352608	0.735	Ryanodine receptor 1
20	9606.ENSP00000348460	0.715	Neuronal PAS domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051018	1.000	protein kinase A binding
GO:0044325	1.000	transmembrane transporter binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0050896	0.979	response to stimulus
GO:0051716	0.953	cellular response to stimulus
GO:0048518	0.926	positive regulation of biological process
GO:0048522	0.871	positive regulation of cellular process
GO:1904427	0.857	positive regulation of calcium ion transmembrane transport
GO:1901700	0.823	response to oxygen-containing compound
GO:0071495	0.813	cellular response to endogenous stimulus
GO:0010243	0.810	response to organonitrogen compound
GO:0065008	0.809	regulation of biological quality
GO:0071417	0.797	cellular response to organonitrogen compound
GO:0071407	0.792	cellular response to organic cyclic compound
GO:1901019	0.785	regulation of calcium ion transmembrane transporter activity
GO:0010880	0.783	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:1901701	0.766	cellular response to oxygen-containing compound
GO:2001259	0.759	positive regulation of cation channel activity
GO:0014074	0.756	response to purine-containing compound
GO:0071320	0.751	cellular response to cAMP
GO:0042391	0.719	regulation of membrane potential
GO:0043266	0.711	regulation of potassium ion transport
GO:0007154	0.502	cell communication
GO:0023052	0.490	signaling
GO:0019222	0.478	regulation of metabolic process
GO:0060255	0.432	regulation of macromolecule metabolic process
GO:0048519	0.429	negative regulation of biological process
GO:0010646	0.429	regulation of cell communication
GO:0080090	0.402	regulation of primary metabolic process
GO:0051171	0.398	regulation of nitrogen compound metabolic process
GO:0007165	0.397	signal transduction
GO:0048523	0.386	negative regulation of cellular process
GO:0031323	0.337	regulation of cellular metabolic process
GO:0009893	0.329	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005635	1.000	nuclear envelope
GO:0031090	0.975	organelle membrane
GO:0005737	0.874	cytoplasm
GO:0031965	0.727	nuclear membrane
GO:0005829	0.537	cytosol
GO:0032991	0.472	protein-containing complex
GO:0070013	0.437	intracellular organelle lumen
GO:0031981	0.430	nuclear lumen
GO:0048471	0.419	perinuclear region of cytoplasm
GO:0005783	0.375	endoplasmic reticulum
GO:0016529	0.374	sarcoplasmic reticulum
GO:0034704	0.369	calcium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]