StarFunc result for job id Q13029

User Input

>input (1718 residues)
MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFV
GDKKKRSQVKNNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINR
AIYYKTLKPIAPGEELLVWYNGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKN
KGNKIQDIQLKTSEPDFTSANMRDSAEGPKEDEEKPSASALEQPATLQEVASQEVPPELA
TPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEEEEDDDDDELEDEGEEEASMP
NENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEANGDVFETFMF
PCQHCERKFTTKQGLERHMHIHISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKP
SQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSSVVEENGEVK
ELHPCKYCKKVFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVYVP
STEPEEEGEADDVYIMDISSNISENLNYYIDGKIQTNNNTSNCDVIEMESASADLYGINC
LLTPVTVEITQNIKTTQVPVTEDLPKEPLGSTNSEAKKRRTASPPALPKIKAETDSDPMV
PSCSLSLPLSISTTEAVSFHKEKSVYLSSKLKQLLQTQDKLTPAGISATEIAKLGPVCVS
APASMLPVTSSRFKRRTSSPPSSPQHSPALRDFGKPSDGKAAWTDAGLTSKKSKLESHSD
SPAWSLSGRDERETVSPPCFDEYKMSKEWTASSAFSSVCNQQPLDLSSGVKQKAEGTGKT
PVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNEYNGID
LPVENPADGTRSPSPCKSLEAQPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQ
LPPLLIPTDPSSPPPCPPVLTVATPPPPLLPTVPLPAPSSSASPHPCPSPLSNATAQSPL
PILSPTVSPSPSPIPPVEPLMSAASPGPPTLSSSSSSSSSSSSFSSSSSSSSPSPPPLSA
ISSVVSSGDNLEASLPMISFKQEELENEGLKPREEPQSAAEQDVVVQETFNKNFVCNVCE
SPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNIFVCSVCKKEF
AFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEE
ELNDSSEELYTTIKIMASGIKTKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNF
TTHNIPQTFTTAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPK
NGVVVLDNSGKNAFRRMGQPKRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSA
KQKADLKNACESSSHICPYCNREFTYIGSLNKHAAFSCPKKPLSPPKKKVSHSSKKGGHS
SPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSGPTQVPLPSSSFRSKQNVKFA
ASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRSLHVRVQKSKA
VLQSKSTLASKKRTDRFNIKSRERSGGPVTRSLQLAAAADLSENKREDGSAKQELKDFSY
SLRLASRCSPPAAPYITRQYRKVKAPAAAQFQGPFFKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A7B5	0.159	0.160	0.000	1709	0.843	0.848	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
2	AFDB:Q13029	0.999	0.999	0.000	1718	1.000	1.000	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
3	AFDB:Q7TSH3	0.047	0.064	8.674E-9	1157	0.100	0.148	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
4	AFDB:O15090	0.048	0.059	2.409E-8	1300	0.125	0.165	O15090.pdb.gz	ZN536_HUMAN Zinc finger protein 536 OS=Homo sapiens OX=9606 GN=ZNF536 PE=1 SV=3
5	AFDB:Q62255	0.038	0.041	5.260E-8	1320	0.129	0.168	Q62255.pdb.gz	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
6	AFDB:Q3UG20	0.061	0.056	9.591E-8	1868	0.136	0.125	Q3UG20.pdb.gz	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
7	AFDB:Q8IZD2	0.068	0.064	1.148E-7	1858	0.132	0.122	Q8IZD2.pdb.gz	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
8	AFDB:A0A0R4INF0	0.039	0.041	4.055E-7	1570	0.133	0.145	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
9	AFDB:Q9H0D2	0.043	0.053	2.560E-5	1346	0.125	0.159	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
10	AFDB:Q90ZW5	0.038	0.048	4.140E-5	1261	0.111	0.151	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
11	PDB:5h6zA	0.054	0.626	8.496E-5	123	0.013	0.179	5h6zA.pdb.gz
12	PDB:5hynA	0.059	0.166	1.645E-4	581	0.017	0.050	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
13	PDB:7td5A	0.058	0.186	2.222E-4	497	0.017	0.058	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
14	PDB:7td5F	0.058	0.206	2.359E-4	447	0.017	0.065	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:2g46A	0.052	0.567	5.809E-4	119	0.012	0.176	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
16	PDB:5wg6A	0.057	0.180	7.844E-4	517	0.016	0.052	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
17	PDB:7ksoA	0.056	0.231	1.519E-3	395	0.016	0.068	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
18	PDB:1pegA	0.057	0.324	4.218E-3	266	0.015	0.098	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
19	PDB:6wkrC	0.058	0.154	4.479E-3	606	0.017	0.048	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
20	PDB:5v3hA	0.037	0.127	2.011E-2	438	0.007	0.027	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A7B5	0.0	2545	1709	0.842	0.846	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
2	B9EKQ3	0.0	2479	1670	0.822	0.846	B9EKQ3_MOUSE Prdm2 protein OS=Mus musculus OX=10090 GN=Prdm2 PE=2 SV=1
3	Q13029	0.0	3526	1718	1.000	1.000	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
4	Q63755	0.0	2556	1706	0.840	0.846	PRDM2_RAT PR domain zinc finger protein 2 OS=Rattus norvegicus OX=10116 GN=Prdm2 PE=1 SV=1
5	Q80VF3	0.0	944	547	0.285	0.894	Q80VF3_MOUSE Prdm2 protein (Fragment) OS=Mus musculus OX=10090 GN=Prdm2 PE=2 SV=1
6	A2A7B7	5.94e-110	348	169	0.095	0.964	A2A7B7_MOUSE PR domain containing 2, with ZNF domain (Fragment) OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
7	Q8C2W5	2.26e-95	306	152	0.086	0.974	Q8C2W5_MOUSE PR domain containing 2, with ZNF domain (Fragment) OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
8	P14404	3.57e-23	110	1232	0.030	0.041	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
9	Q03112	8.82e-23	108	1230	0.031	0.043	MECOM_HUMAN Histone-lysine N-methyltransferase MECOM OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=3
10	Q96EQ9	4.22e-19	96.7	843	0.028	0.057	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
11	Q9NQV7	3.02e-18	94.0	894	0.027	0.053	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
12	Q9NQW5	5.40e-16	85.5	492	0.026	0.091	PRDM7_HUMAN Histone-lysine N-methyltransferase PRDM7 OS=Homo sapiens OX=9606 GN=PRDM7 PE=1 SV=2
13	D4A1S2	6.68e-16	86.3	824	0.027	0.056	D4A1S2_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
14	A2A935	1.22e-15	85.5	1275	0.027	0.037	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
15	A0A096MJU6	1.47e-15	85.1	857	0.028	0.056	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
16	Q68EH4	1.59e-15	84.7	776	0.027	0.061	Q68EH4_DANRE PR domain zinc finger protein 1 OS=Danio rerio OX=7955 GN=Blimp-1 PE=2 SV=2
17	Q60636	1.91e-15	84.7	856	0.027	0.054	PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus OX=10090 GN=Prdm1 PE=1 SV=1
18	O75626	3.67e-15	84.0	825	0.025	0.052	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
19	Q9NQX0	6.91e-15	82.4	595	0.029	0.084	PRDM6_HUMAN Putative histone-lysine N-methyltransferase PRDM6 OS=Homo sapiens OX=9606 GN=PRDM6 PE=1 SV=2
20	Q3UZD5	9.95e-15	82.0	596	0.029	0.084	PRDM6_MOUSE Putative histone-lysine N-methyltransferase PRDM6 OS=Mus musculus OX=10090 GN=Prdm6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00856 SET	0.0002	33.3	SET domain
2	PF00096 zf-C2H2	1.9e-15	67.5	Zinc finger, C2H2 type
3	PF16622 zf-C2H2_11	33	15.6	zinc-finger C2H2-type
4	PF13894 zf-C2H2_4	1e-13	61.8	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	1.8e-11	55.0	C2H2-type zinc finger
6	PF12171 zf-C2H2_jaz	4.6e+02	12.5	Zinc-finger double-stranded RNA-binding
7	PF16278 zf-C2HE	94	14.9	C2HE / C2H2 / C2HC zinc-binding finger
8	PF10276 zf-CHCC	1.5e+02	13.9	Zinc-finger domain
9	PF17772 zf-MYST	8.6e+02	11.0	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000235372

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405330	0.828	Estrogen receptor
2	9606.ENSP00000263253	0.781	Histone acetyltransferase p300
3	9606.ENSP00000367755	0.777	Calmodulin-lysine N-methyltransferase
4	9606.ENSP00000339764	0.758	PR domain zinc finger protein 8
5	9606.ENSP00000358217	0.705	PR domain zinc finger protein 13
6	9606.ENSP00000262189	0.693	Histone-lysine N-methyltransferase 2C
7	9606.ENSP00000385852	0.677	SET domain-containing protein 5
8	9606.ENSP00000355657	0.676	Histone H3.1t
9	9606.ENSP00000339004	0.675	Forkhead box protein G1
10	9606.ENSP00000462269	0.652	Zinc finger protein 488
11	9606.ENSP00000196061	0.650	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
12	9606.ENSP00000223127	0.650	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
13	9606.ENSP00000282903	0.650	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
14	9606.ENSP00000269305	0.646	Cellular tumor antigen p53
15	9606.ENSP00000337976	0.631	Histone-lysine N-methyltransferase SUV39H1
16	9606.ENSP00000346997	0.631	Histone-lysine N-methyltransferase SUV39H2
17	9606.ENSP00000349547	0.628	Ras association domain-containing protein 1
18	9606.ENSP00000351141	0.605	Pre-mRNA-splicing regulator WTAP
19	9606.ENSP00000347648	0.591	Zinc finger protein 512
20	9606.ENSP00000346175	0.587	Histone-lysine N-methyltransferase SETDB2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001217	1.000	DNA-binding transcription repressor activity
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.995	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0005515	0.994	protein binding
GO:0001227	0.991	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003824	0.486	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.972	regulation of cellular process
GO:0019222	0.959	regulation of metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0019219	0.945	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.918	regulation of gene expression
GO:0010556	0.887	regulation of macromolecule biosynthetic process
GO:2001141	0.876	regulation of RNA biosynthetic process
GO:0048519	0.854	negative regulation of biological process
GO:0006355	0.823	regulation of DNA-templated transcription
GO:0048518	0.780	positive regulation of biological process
GO:0048523	0.771	negative regulation of cellular process
GO:0009893	0.705	positive regulation of metabolic process
GO:0010604	0.702	positive regulation of macromolecule metabolic process
GO:0048522	0.694	positive regulation of cellular process
GO:0010605	0.694	negative regulation of macromolecule metabolic process
GO:0051173	0.677	positive regulation of nitrogen compound metabolic process
GO:0051172	0.672	negative regulation of nitrogen compound metabolic process
GO:0009890	0.672	negative regulation of biosynthetic process
GO:0006357	0.671	regulation of transcription by RNA polymerase II
GO:0031324	0.669	negative regulation of cellular metabolic process
GO:0045934	0.664	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.658	negative regulation of macromolecule biosynthetic process
GO:0031327	0.655	negative regulation of cellular biosynthetic process
GO:0031325	0.647	positive regulation of cellular metabolic process
GO:0045892	0.624	negative regulation of DNA-templated transcription
GO:0045935	0.610	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.510	positive regulation of DNA-templated transcription
GO:0000122	0.478	negative regulation of transcription by RNA polymerase II
GO:0050896	0.430	response to stimulus
GO:0009987	0.427	cellular process
GO:0045944	0.302	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.959	cytoplasm
GO:0012505	0.946	endomembrane system
GO:0005794	0.499	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]