StarFunc result for job id Q13033

User Input

>input (797 residues)
MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRP
QQYTIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKM
LEYALKQERAKYHKLKYGTELNQGDLKMPTFESEETKDTEAPTAPQNSQLTWKQGRQLLR
QYLQEVGYTDTILDVRSQRVRSLLGLSNSEPNGSVETKNLEQILNGGESPKQKGQEIKRS
SGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE
ALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKERK
GKKGVKRANRTKLYDMIADLGDDELPHIPSGIINQSRSASTRMTDHEGARAEEAEPITFP
SGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHF
DGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLA
ISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQ
LLSCSADGTVRLWNPQEKLPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYD
LETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMV
AHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDESIYDVAFHSS
KAYIASAGADALAKVFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0AV58	0.512	0.568	0.000	713	0.893	0.999	A0AV58.pdb.gz	A0AV58_HUMAN Striatin, calmodulin binding protein 3 OS=Homo sapiens OX=9606 GN=STRN3 PE=2 SV=1
2	AFDB:Q13033	1.000	1.000	0.000	797	1.000	1.000	Q13033.pdb.gz	STRN3_HUMAN Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3
3	AFDB:O43815	0.513	0.524	2.127E-86	780	0.632	0.646	O43815.pdb.gz	STRN_HUMAN Striatin OS=Homo sapiens OX=9606 GN=STRN PE=1 SV=4
4	AFDB:F1M6V8	0.485	0.507	2.718E-70	759	0.498	0.523	F1M6V8.pdb.gz	F1M6V8_RAT Striatin 4 OS=Rattus norvegicus OX=10116 GN=Strn4 PE=1 SV=1
5	AFDB:M9PF42	0.415	0.457	7.133E-69	722	0.457	0.504	M9PF42.pdb.gz	M9PF42_DROME Connector of kinase to AP-1, isoform G OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
6	AFDB:D3DML3	0.433	0.461	8.869E-69	749	0.464	0.494	D3DML3.pdb.gz	D3DML3_DROME Connector of kinase to AP-1, isoform E OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
7	PDB:1vyhC	0.344	0.854	6.779E-24	310	0.090	0.232	1vyhC.pdb.gz
8	PDB:2h9lA	0.354	0.847	1.169E-23	321	0.102	0.252	2h9lA.pdb.gz
9	AFDB:K7EMK7	0.353	0.378	7.556E-23	744	0.151	0.161	K7EMK7.pdb.gz	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
10	PDB:5a2qg	0.356	0.872	1.779E-22	314	0.088	0.223	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
11	PDB:7mq8LU	0.347	0.609	1.879E-22	445	0.090	0.162	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:P16371	0.347	0.378	4.558E-22	730	0.149	0.163	P16371.pdb.gz	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
13	PDB:3dm0A	0.351	0.413	8.175E-22	675	0.089	0.105	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
14	PDB:5mzhB	0.327	0.598	9.115E-22	415	0.088	0.169	5mzhB.pdb.gz
15	PDB:5nnzA	0.322	0.709	1.409E-21	335	0.080	0.191	5nnzA.pdb.gz
16	AFDB:F4JUD2	0.346	0.286	2.750E-21	969	0.158	0.130	F4JUD2.pdb.gz	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1
17	PDB:4v6wAg	0.344	0.829	4.188E-21	318	0.088	0.220	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:7pzyh	0.356	0.879	1.001E-20	311	0.082	0.209	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
19	PDB:7jvrB	0.348	0.780	1.314E-20	342	0.083	0.193	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
20	AFDB:H0YL70	0.347	0.353	6.834E-20	782	0.153	0.156	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JX43	0.0	632	670	0.464	0.552	A0A0G2JX43_RAT Striatin 4 OS=Rattus norvegicus OX=10116 GN=Strn4 PE=1 SV=1
2	A0A8I6AK86	0.0	639	665	0.468	0.561	A0A8I6AK86_RAT Striatin 4 OS=Rattus norvegicus OX=10116 GN=Strn4 PE=1 SV=1
3	A0AV58	0.0	945	713	0.708	0.791	A0AV58_HUMAN Striatin, calmodulin binding protein 3 OS=Homo sapiens OX=9606 GN=STRN3 PE=2 SV=1
4	B5DF70	0.0	592	634	0.438	0.550	B5DF70_RAT Strn4 protein OS=Rattus norvegicus OX=10116 GN=Strn4 PE=2 SV=1
5	F1M6V8	0.0	700	759	0.498	0.523	F1M6V8_RAT Striatin 4 OS=Rattus norvegicus OX=10116 GN=Strn4 PE=1 SV=1
6	O43815	0.0	989	780	0.626	0.640	STRN_HUMAN Striatin OS=Homo sapiens OX=9606 GN=STRN PE=1 SV=4
7	P58405	0.0	1515	794	0.950	0.953	STRN3_RAT Striatin-3 OS=Rattus norvegicus OX=10116 GN=Strn3 PE=1 SV=2
8	P70483	0.0	984	780	0.621	0.635	STRN_RAT Striatin OS=Rattus norvegicus OX=10116 GN=Strn PE=1 SV=1
9	Q13033	0.0	1653	797	1.000	1.000	STRN3_HUMAN Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3
10	Q9NRL3	0.0	710	753	0.503	0.533	STRN4_HUMAN Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2
11	M9PF42	1.43e-168	506	722	0.295	0.325	M9PF42_DROME Connector of kinase to AP-1, isoform G OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
12	M9NEC0	2.40e-168	506	747	0.295	0.315	M9NEC0_DROME Connector of kinase to AP-1, isoform F OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
13	Q9VLT9	2.50e-168	506	730	0.292	0.319	Q9VLT9_DROME Connector of kinase to AP-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=2
14	Q86M30	3.38e-168	505	730	0.292	0.319	Q86M30_DROME WD-40 family member protein OS=Drosophila melanogaster OX=7227 GN=Cka PE=2 SV=1
15	D3DML3	3.72e-168	506	749	0.295	0.314	D3DML3_DROME Connector of kinase to AP-1, isoform E OS=Drosophila melanogaster OX=7227 GN=Cka PE=1 SV=1
16	G5EE12	2.61e-117	372	678	0.247	0.291	G5EE12_CAEEL Striatin N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cash-1 PE=1 SV=1
17	Q70M86	5.09e-34	142	845	0.144	0.136	STRN_SORMK Striatin Pro11 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) OX=771870 GN=pro11 PE=3 SV=1
18	Q0VAF9	4.80e-29	113	96	0.072	0.594	Q0VAF9_HUMAN LOC729862 protein OS=Homo sapiens OX=9606 GN=LOC729862 PE=1 SV=1
19	Q0VAF8	7.87e-28	111	129	0.070	0.434	Q0VAF8_HUMAN LOC729862 protein OS=Homo sapiens OX=9606 GN=LOC729862 PE=1 SV=1
20	Q7T394	2.15e-22	102	410	0.105	0.205	LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio OX=7955 GN=pafah1b1a PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00057	31.4	Anaphase-promoting complex subunit 4 WD40 domain
2	PF14818 DUF4482	7.3e+02	12.4	Domain of unknown function (DUF4482)
3	PF20426 NBCH_WD40	0.00014	32.5	Neurobeachin beta propeller domain
4	PF11715 Nup160	1.9	18.8	Nucleoporin Nup120/160
5	PF08232 Striatin	8.9e-39	144.9	Striatin family
6	PF00400 WD40	2.7e-31	118.3	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249344	0.999	Striatin-interacting protein 2
2	9606.ENSP00000263918	0.999	Striatin
3	9606.ENSP00000324804	0.999	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
4	9606.ENSP00000358541	0.999	Suppressor of IKBKE 1
5	9606.ENSP00000358810	0.999	Striatin-interacting protein 1
6	9606.ENSP00000375777	0.999	Striatin-4
7	9606.ENSP00000295951	0.998	Sarcolemmal membrane-associated protein
8	9606.ENSP00000377867	0.998	Serine/threonine-protein kinase 26
9	9606.ENSP00000221138	0.997	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
10	9606.ENSP00000229395	0.997	FGFR1 oncogene partner 2
11	9606.ENSP00000311344	0.997	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
12	9606.ENSP00000315702	0.997	MOB-like protein phocein
13	9606.ENSP00000325748	0.997	Serine/threonine-protein kinase 25
14	9606.ENSP00000365730	0.997	Serine/threonine-protein kinase 24
15	9606.ENSP00000418447	0.997	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
16	9606.ENSP00000160373	0.996	Cortactin-binding protein 2
17	9606.ENSP00000271277	0.996	CTTNBP2 N-terminal-like protein
18	9606.ENSP00000355991	0.996	TRAF3-interacting JNK-activating modulator
19	9606.ENSP00000376506	0.995	Programmed cell death protein 10
20	9606.ENSP00000317334	0.994	T-complex protein 1 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0019899	1.000	enzyme binding
GO:0019904	0.932	protein domain specific binding
GO:0019903	0.427	protein phosphatase binding
GO:0051721	0.394	protein phosphatase 2A binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048519	0.983	negative regulation of biological process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0019219	0.957	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.954	regulation of biosynthetic process
GO:0048523	0.940	negative regulation of cellular process
GO:0009987	0.923	cellular process
GO:0010556	0.869	regulation of macromolecule biosynthetic process
GO:0031326	0.868	regulation of cellular biosynthetic process
GO:0006355	0.846	regulation of DNA-templated transcription
GO:0048518	0.806	positive regulation of biological process
GO:0048522	0.780	positive regulation of cellular process
GO:0009892	0.759	negative regulation of metabolic process
GO:0010605	0.749	negative regulation of macromolecule metabolic process
GO:0031324	0.702	negative regulation of cellular metabolic process
GO:0010604	0.699	positive regulation of macromolecule metabolic process
GO:0051173	0.694	positive regulation of nitrogen compound metabolic process
GO:0031325	0.688	positive regulation of cellular metabolic process
GO:0051172	0.687	negative regulation of nitrogen compound metabolic process
GO:1903507	0.657	negative regulation of nucleic acid-templated transcription
GO:0045892	0.633	negative regulation of DNA-templated transcription
GO:0050896	0.576	response to stimulus
GO:0031328	0.568	positive regulation of cellular biosynthetic process
GO:0045935	0.568	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.567	positive regulation of macromolecule biosynthetic process
GO:0048583	0.531	regulation of response to stimulus
GO:0051716	0.373	cellular response to stimulus
GO:0023051	0.348	regulation of signaling
GO:0010646	0.348	regulation of cell communication
GO:0045893	0.329	positive regulation of DNA-templated transcription
GO:0008152	0.328	metabolic process
GO:0071704	0.318	organic substance metabolic process
GO:0009966	0.317	regulation of signal transduction
GO:0000122	0.311	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.999	protein-containing complex
GO:0005654	0.988	nucleoplasm
GO:0012505	0.977	endomembrane system
GO:0016020	0.970	membrane
GO:0071944	0.909	cell periphery
GO:0005829	0.867	cytosol
GO:0005886	0.525	plasma membrane
GO:0042995	0.396	cell projection
GO:0120025	0.383	plasma membrane bounded cell projection
GO:0036477	0.315	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]