StarFunc result for job id Q13043

User Input

>input (487 residues)
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A648	0.803	0.803	5.534E-75	487	0.959	0.959	D4A648.pdb.gz	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
2	AFDB:Q9JI10	0.800	0.784	4.486E-67	497	0.778	0.763	Q9JI10.pdb.gz	STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Stk3 PE=1 SV=1
3	AFDB:Q7ZUQ3	0.787	0.779	2.946E-66	492	0.770	0.762	Q7ZUQ3.pdb.gz	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1
4	AFDB:F5H5B4	0.675	0.759	1.313E-60	432	0.885	0.998	F5H5B4.pdb.gz	F5H5B4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=1
5	AFDB:Q8T0S6	0.650	0.476	1.752E-52	669	0.577	0.420	Q8T0S6.pdb.gz	HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster OX=7227 GN=hpo PE=1 SV=1
6	AFDB:Q9NB31	0.693	0.679	5.665E-49	497	0.524	0.513	Q9NB31.pdb.gz	CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans OX=6239 GN=cst-1 PE=1 SV=1
7	AFDB:O61125	0.567	0.598	2.139E-43	461	0.444	0.469	O61125.pdb.gz	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
8	AFDB:Q55FS2	0.569	0.253	5.605E-37	1105	0.380	0.167	Q55FS2.pdb.gz	STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum OX=44689 GN=krsB PE=3 SV=1
9	AFDB:F8W562	0.547	0.631	6.618E-37	421	0.349	0.404	F8W562.pdb.gz	F8W562_DANRE Serine/threonine kinase 25a OS=Danio rerio OX=7955 GN=zgc:92836 PE=4 SV=1
10	AFDB:Q9Y6E0	0.556	0.610	8.258E-37	443	0.347	0.381	Q9Y6E0.pdb.gz	STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens OX=9606 GN=STK24 PE=1 SV=1
11	PDB:3eqdA	0.491	0.735	7.879E-24	315	0.201	0.311	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:5eymA	0.454	0.729	2.158E-20	292	0.185	0.308	5eymA.pdb.gz	Pharmacological Profile of BI 847325, an Orally Bioavailable, ATP-Competitive Inhibitor of MEK and Aurora Kinases.
13	PDB:4eomC	0.450	0.766	6.316E-19	276	0.166	0.293	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
14	PDB:5u6yA	0.446	0.472	1.227E-18	459	0.162	0.172	5u6yA.pdb.gz
15	PDB:8bfsA	0.408	0.679	1.449E-18	274	0.146	0.259	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
16	PDB:4c0tA	0.474	0.767	8.058E-18	291	0.144	0.241	4c0tA.pdb.gz
17	PDB:2yaaA	0.459	0.721	1.063E-17	300	0.158	0.257	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
18	PDB:8a8mB	0.469	0.736	1.123E-17	298	0.191	0.312	8a8mB.pdb.gz	Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
19	PDB:6s73A	0.454	0.796	1.401E-17	269	0.160	0.290	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
20	PDB:1unlA	0.450	0.730	1.954E-17	292	0.148	0.247	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A648	0.0	920	488	0.938	0.936	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
2	F5H5B4	0.0	729	432	0.809	0.912	F5H5B4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=1
3	Q13043	0.0	1013	487	1.000	1.000	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
4	Q13188	0.0	751	491	0.780	0.774	STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2
5	Q7ZUQ3	0.0	733	492	0.770	0.762	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1
6	Q9JI10	0.0	744	497	0.784	0.769	STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Stk3 PE=1 SV=1
7	Q9JI11	0.0	989	487	0.973	0.973	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1
8	Q9NB31	1.73e-175	504	497	0.534	0.523	CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans OX=6239 GN=cst-1 PE=1 SV=1
9	Q8T0S6	2.04e-166	487	669	0.520	0.378	HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster OX=7227 GN=hpo PE=1 SV=1
10	O61125	1.98e-134	398	461	0.464	0.490	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1
11	Q55FS2	9.39e-108	347	1105	0.335	0.148	STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum OX=44689 GN=krsB PE=3 SV=1
12	O61122	3.08e-101	313	478	0.302	0.308	SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum OX=44689 GN=svkA PE=1 SV=1
13	F8W562	1.22e-100	310	421	0.335	0.387	F8W562_DANRE Serine/threonine kinase 25a OS=Danio rerio OX=7955 GN=zgc:92836 PE=4 SV=1
14	H2L099	4.23e-100	316	653	0.310	0.231	GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans OX=6239 GN=gck-1 PE=1 SV=1
15	Q7SYN3	3.09e-99	306	420	0.322	0.374	Q7SYN3_DANRE Serine/threonine kinase 24 (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk24 PE=1 SV=1
16	Q96BA2	5.25e-99	306	426	0.324	0.371	Q96BA2_HUMAN STK25 protein OS=Homo sapiens OX=9606 PE=1 SV=1
17	O00506	5.78e-99	306	426	0.324	0.371	STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens OX=9606 GN=STK25 PE=1 SV=1
18	Q7ZVG8	5.80e-99	306	424	0.318	0.366	Q7ZVG8_DANRE Serine/threonine kinase 25 (STE20 homolog, yeast) OS=Danio rerio OX=7955 GN=stk25 PE=2 SV=1
19	Q6V9V9	8.99e-99	305	426	0.324	0.371	Q6V9V9_RAT Serine/threonine kinase 25 OS=Rattus norvegicus OX=10116 GN=Stk25 PE=1 SV=1
20	Q9Z2W1	8.99e-99	305	426	0.324	0.371	STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus OX=10090 GN=Stk25 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	5.2e-08	43.9	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	1.4e+02	12.8	Haspin like kinase domain
3	PF11629 Mst1_SARAH	2.6e-22	89.8	C terminal SARAH domain of Mst1
4	PF00069 Pkinase	2.7e-69	245.1	Protein kinase domain
5	PF17667 Pkinase_fungal	0.0026	28.2	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	1.5e-50	183.5	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361892

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324729	0.999	Protein salvador homolog 1
2	9606.ENSP00000462099	0.999	Ras association domain-containing protein 5
3	9606.ENSP00000379364	0.998	MOB kinase activator 1A
4	9606.ENSP00000349547	0.996	Ras association domain-containing protein 1
5	9606.ENSP00000372035	0.994	Serine/threonine-protein kinase LATS2
6	9606.ENSP00000379366	0.993	MOB kinase activator 1B
7	9606.ENSP00000437550	0.988	Serine/threonine-protein kinase LATS1
8	9606.ENSP00000478927	0.977	Transcriptional coactivator YAP1
9	9606.ENSP00000429744	0.973	Serine/threonine-protein kinase 3
10	9606.ENSP00000311032	0.969	Caspase-3
11	9606.ENSP00000368710	0.959	Ras association domain-containing protein 2
12	9606.ENSP00000385824	0.925	Forkhead box protein O3
13	9606.ENSP00000419465	0.910	WW domain-containing transcription regulator protein 1
14	9606.ENSP00000332449	0.902	Cysteine-rich protein 1
15	9606.ENSP00000368880	0.899	Forkhead box protein O1
16	9606.ENSP00000340578	0.877	Ras association domain-containing protein 6
17	9606.ENSP00000339692	0.872	Ras association domain-containing protein 4
18	9606.ENSP00000361027	0.868	Angiomotin
19	9606.ENSP00000443021	0.835	Ras association domain family member 3
20	9606.ENSP00000363377	0.832	Forkhead box protein O4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004672	0.998	protein kinase activity
GO:0004674	0.977	protein serine/threonine kinase activity
GO:0042802	0.424	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0050896	0.982	response to stimulus
GO:0007154	0.975	cell communication
GO:0048518	0.974	positive regulation of biological process
GO:0023052	0.967	signaling
GO:0032502	0.960	developmental process
GO:0048522	0.953	positive regulation of cellular process
GO:0030111	0.940	regulation of Wnt signaling pathway
GO:0060828	0.908	regulation of canonical Wnt signaling pathway
GO:0051716	0.901	cellular response to stimulus
GO:0007165	0.886	signal transduction
GO:0019222	0.852	regulation of metabolic process
GO:0060255	0.841	regulation of macromolecule metabolic process
GO:0006915	0.827	apoptotic process
GO:0048519	0.826	negative regulation of biological process
GO:0051171	0.819	regulation of nitrogen compound metabolic process
GO:0080090	0.815	regulation of primary metabolic process
GO:0023057	0.815	negative regulation of signaling
GO:0009968	0.806	negative regulation of signal transduction
GO:0030178	0.795	negative regulation of Wnt signaling pathway
GO:0048856	0.794	anatomical structure development
GO:0042981	0.760	regulation of apoptotic process
GO:0010942	0.707	positive regulation of cell death
GO:0031323	0.698	regulation of cellular metabolic process
GO:0043065	0.656	positive regulation of apoptotic process
GO:0071704	0.631	organic substance metabolic process
GO:0044237	0.623	cellular metabolic process
GO:0044238	0.618	primary metabolic process
GO:0032501	0.578	multicellular organismal process
GO:0006807	0.492	nitrogen compound metabolic process
GO:0035556	0.491	intracellular signal transduction
GO:0010604	0.467	positive regulation of macromolecule metabolic process
GO:0051173	0.462	positive regulation of nitrogen compound metabolic process
GO:0051246	0.446	regulation of protein metabolic process
GO:0043170	0.434	macromolecule metabolic process
GO:0065009	0.347	regulation of molecular function
GO:0010468	0.342	regulation of gene expression
GO:0036211	0.340	protein modification process
GO:0009889	0.327	regulation of biosynthetic process
GO:0031325	0.320	positive regulation of cellular metabolic process
GO:0090090	0.317	negative regulation of canonical Wnt signaling pathway
GO:0031647	0.309	regulation of protein stability
GO:0019219	0.306	regulation of nucleobase-containing compound metabolic process
GO:0007275	0.305	multicellular organism development
GO:0051252	0.304	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.998	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0032991	0.987	protein-containing complex
GO:0005829	0.983	cytosol
GO:0016604	0.497	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.

[back to server]