StarFunc result for job id Q13045

User Input

>input (1269 residues)
MEATGVLPFVRGVDLSGNDFKGGYFPENVKAMTSLRWLKLNRTGLCYLPEELAALQKLEH
LSVSHNNLTTLHGELSSLPSLRAIVARANSLKNSGVPDDIFKLDDLSVLDLSHNQLTECP
RELENAKNMLVLNLSHNSIDTIPNQLFINLTDLLYLDLSENRLESLPPQMRRLVHLQTLV
LNGNPLLHAQLRQLPAMTALQTLHLRSTQRTQSNLPTSLEGLSNLADVDLSCNDLTRVPE
CLYTLPSLRRLNLSSNQITELSLCIDQWVHVETLNLSRNQLTSLPSAICKLSKLKKLYLN
SNKLDFDGLPSGIGKLTNLEEFMAANNNLELVPESLCRCPKLRKLVLNKNHLVTLPEAIH
FLTEIEVLDVRENPNLVMPPKPADRAAEWYNIDFSLQNQLRLAGASPATVAAAAAAGSGP
KDPMARKMRLRRRKDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGL
EKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGS
LNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISY
IEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWR
GAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPED
FWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDC
WSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDD
VLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW
NEDLDGMEGFVLEGKKFARLPEEEFGHFYTQDCYVFLCRYWVPVEYEEEEKKEDKEEKAE
GKEGEEATAEAEEKQPEEDFQCIVYFWQGREASNMGWLTFTFSLQKKFESLFPGKLEVVR
MTQQQENPKFLSHFKRKFIIHRGKRKAVQGAQQPSLYQIRTNGSALCTRCIQINTDSSLL
NSEFCFILKVPFESEDNQGIVYAWVGRASDPDEAKLAEDILNTMFDTSYSKQVINEGEEP
ENFFWVGIGAQKPYDDDAEYMKHTRLFRCSNEKGYFAVTEKCSDFCQDDLADDDIMLLDN
GQEVYMWVGTQTSQVEIKLSLKACQVYIQHMRSKEHERPRRLRLVRKGNEQHAFTRCFHA
WSAFCKALA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8WK50	0.651	0.656	0.000	1259	0.832	0.839	F8WK50.pdb.gz	F8WK50_DANRE Flightless I OS=Danio rerio OX=7955 GN=im:7141769 PE=1 SV=1
2	AFDB:P34268	0.580	0.585	0.000	1257	0.503	0.508	P34268.pdb.gz	FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans OX=6239 GN=fli-1 PE=2 SV=2
3	AFDB:Q24020	0.608	0.613	0.000	1256	0.562	0.568	Q24020.pdb.gz	FLII_DROME Protein flightless-1 OS=Drosophila melanogaster OX=7227 GN=fliI PE=2 SV=1
4	AFDB:Q9JJ28	0.538	0.537	0.000	1271	0.951	0.950	Q9JJ28.pdb.gz	FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus OX=10090 GN=Flii PE=1 SV=1
5	AFDB:E9PU64	0.257	0.428	9.351E-49	715	0.162	0.288	E9PU64.pdb.gz	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
6	AFDB:A0A0R4IQ11	0.252	0.420	2.090E-47	720	0.161	0.283	A0A0R4IQ11.pdb.gz
7	AFDB:Q5ZIV9	0.280	0.462	5.547E-47	717	0.173	0.305	Q5ZIV9.pdb.gz	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
8	AFDB:P09327	0.226	0.335	3.132E-46	827	0.168	0.258	P09327.pdb.gz	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
9	AFDB:P36418	0.283	0.362	4.087E-46	959	0.159	0.211	P36418.pdb.gz	VILB_DICDI Protovillin OS=Dictyostelium discoideum OX=44689 GN=vilB PE=1 SV=1
10	AFDB:O88398	0.225	0.337	5.102E-46	819	0.168	0.260	O88398.pdb.gz	AVIL_MOUSE Advillin OS=Mus musculus OX=10090 GN=Avil PE=1 SV=2
11	PDB:6jegB	0.169	0.280	9.158E-42	718	0.156	0.276	6jegB.pdb.gz
12	PDB:1j72A	0.118	0.331	1.005E-23	337	0.084	0.315	1j72A.pdb.gz
13	PDB:7tvfD	0.237	0.522	4.690E-17	515	0.098	0.241	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
14	PDB:7p5vB	0.218	0.362	1.271E-12	732	0.072	0.126	7p5vB.pdb.gz
15	PDB:5xjxC	0.192	0.601	3.564E-10	365	0.066	0.230	5xjxC.pdb.gz
16	PDB:6gffI	0.207	0.428	6.635E-10	551	0.085	0.196	6gffI.pdb.gz
17	PDB:6hkwA	0.178	0.611	9.892E-10	306	0.060	0.248	6hkwA.pdb.gz
18	PDB:5yq5B	0.183	0.595	5.342E-9	306	0.060	0.248	5yq5B.pdb.gz
19	PDB:3t6qA	0.197	0.371	4.700E-8	601	0.066	0.140	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:1xcdA	0.156	0.476	5.370E-8	305	0.052	0.216	1xcdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8WK50	0.0	2203	1259	0.830	0.836	F8WK50_DANRE Flightless I OS=Danio rerio OX=7955 GN=im:7141769 PE=1 SV=1
2	J3KS54	0.0	1317	700	0.507	0.920	J3KS54_HUMAN FLII actin remodeling protein OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=1
3	P34268	0.0	1221	1257	0.500	0.504	FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans OX=6239 GN=fli-1 PE=2 SV=2
4	Q13045	0.0	2635	1269	1.000	1.000	FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens OX=9606 GN=FLII PE=1 SV=2
5	Q24020	0.0	1436	1256	0.566	0.572	FLII_DROME Protein flightless-1 OS=Drosophila melanogaster OX=7227 GN=fliI PE=2 SV=1
6	Q9JJ28	0.0	2393	1271	0.946	0.944	FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus OX=10090 GN=Flii PE=1 SV=1
7	Q5ZIV9	7.44e-81	283	717	0.182	0.322	SCIN_CHICK Scinderin OS=Gallus gallus OX=9031 GN=SCIN PE=2 SV=2
8	Q9Y6U3	1.11e-78	277	715	0.180	0.320	SCIN_HUMAN Scinderin OS=Homo sapiens OX=9606 GN=SCIN PE=1 SV=4
9	O75366	1.18e-78	279	819	0.182	0.282	AVIL_HUMAN Advillin OS=Homo sapiens OX=9606 GN=AVIL PE=1 SV=3
10	P20305	2.35e-78	277	772	0.184	0.303	GELS_PIG Gelsolin (Fragment) OS=Sus scrofa OX=9823 GN=GSN PE=1 SV=1
11	P13020	1.70e-76	272	780	0.179	0.291	GELS_MOUSE Gelsolin OS=Mus musculus OX=10090 GN=Gsn PE=1 SV=3
12	E9PU64	1.72e-76	270	715	0.173	0.306	E9PU64_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=1 SV=1
13	Q7TQ08	1.80e-76	270	715	0.173	0.306	Q7TQ08_RAT Scinderin OS=Rattus norvegicus OX=10116 GN=Scin PE=2 SV=1
14	Q9WU06	2.14e-76	273	819	0.185	0.287	AVIL_RAT Advillin OS=Rattus norvegicus OX=10116 GN=Avil PE=2 SV=2
15	P09327	3.03e-76	272	827	0.172	0.264	VILI_HUMAN Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4
16	Q28046	6.99e-76	269	715	0.177	0.315	SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1
17	G1U9R8	1.02e-75	269	739	0.175	0.300	G1U9R8_RABIT Gelsolin OS=Oryctolagus cuniculus OX=9986 GN=GSN PE=3 SV=3
18	P06396	1.13e-74	267	782	0.180	0.293	GELS_HUMAN Gelsolin OS=Homo sapiens OX=9606 GN=GSN PE=1 SV=1
19	Q68FP1	1.37e-74	266	780	0.177	0.288	GELS_RAT Gelsolin OS=Rattus norvegicus OX=10116 GN=Gsn PE=1 SV=1
20	Q60604	2.53e-74	264	715	0.174	0.309	SCIN_MOUSE Scinderin OS=Mus musculus OX=10090 GN=Scin PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00626 Gelsolin	6e-62	216.8	Gelsolin repeat
2	PF00560 LRR_1	1.1e+02	14.7	Leucine Rich Repeat
3	PF12799 LRR_4	5.3e-22	88.7	Leucine Rich repeats (2 copies)
4	PF13855 LRR_8	1.6e-38	141.6	Leucine rich repeat
5	PF14580 LRR_9	5.2	18.1	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375857	0.987	Leucine-rich repeat flightless-interacting protein 1
2	9606.ENSP00000401399	0.976	Myeloid differentiation primary response protein MyD88
3	9606.ENSP00000338727	0.971	Leucine-rich repeat flightless-interacting protein 2
4	9606.ENSP00000400142	0.930	RNA-binding protein EWS
5	9606.ENSP00000397552	0.870	Actin-like protein 6A
6	9606.ENSP00000356520	0.868	ATP-dependent RNA helicase A
7	9606.ENSP00000326570	0.802	Fukutin-related protein
8	9606.ENSP00000321537	0.779	Lethal(2) giant larvae protein homolog 1
9	9606.ENSP00000308753	0.767	Tropomodulin-3
10	9606.ENSP00000318690	0.764	GC-rich sequence DNA-binding factor 2
11	9606.ENSP00000268182	0.738	Ras GTPase-activating-like protein IQGAP1
12	9606.ENSP00000259365	0.681	Tropomodulin-1
13	9606.ENSP00000244520	0.679	U1 small nuclear ribonucleoprotein C
14	9606.ENSP00000264428	0.651	Glycine receptor subunit beta
15	9606.ENSP00000301788	0.649	DNA-directed RNA polymerase II subunit RPB7
16	9606.ENSP00000263253	0.648	Histone acetyltransferase p300
17	9606.ENSP00000414635	0.641	Leucine-rich repeat-containing protein 34
18	9606.ENSP00000458954	0.630	Nuclear pore complex protein Nup88
19	9606.ENSP00000405330	0.603	Estrogen receptor
20	9606.ENSP00000374332	0.597	Translin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.508	cytoskeletal protein binding
GO:0003779	0.453	actin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0030029	0.947	actin filament-based process
GO:0006996	0.923	organelle organization
GO:0007010	0.901	cytoskeleton organization
GO:0030036	0.847	actin cytoskeleton organization
GO:0065007	0.631	biological regulation
GO:0032502	0.559	developmental process
GO:0048856	0.531	anatomical structure development
GO:0050789	0.500	regulation of biological process
GO:0050794	0.488	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005856	0.995	cytoskeleton
GO:0005829	0.989	cytosol
GO:0015630	0.685	microtubule cytoskeleton
GO:0005815	0.425	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]