StarFunc result for job id Q13049

User Input

>input (653 residues)
MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVR
CPFCSKITRITSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLC
EPCREADHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQAR
YKAVLQEYGHEERRVQDELARSRKFFTGSLAEVEKSNSQVVEEQSYLLNIAEVQAVSRCD
YFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRT
VNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAASNIQQCLFLKK
MGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPS
GQFVVTDVEGGKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENR
QNEHHLEGGFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEIL
HFPKGGGYSVLIREGLTCPVGIALTPKGQLLVLDCWDHCIKIYSYHLRRYSTP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CH72	0.479	0.477	0.000	655	0.963	0.960	Q8CH72.pdb.gz	TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus OX=10090 GN=Trim32 PE=1 SV=2
2	AFDB:A0A0R4IL45	0.542	0.535	6.476E-88	663	0.646	0.637	A0A0R4IL45.pdb.gz	A0A0R4IL45_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=3 SV=1
3	AFDB:F1QFW2	0.367	0.324	6.946E-33	744	0.214	0.188	F1QFW2.pdb.gz	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
4	AFDB:D3ZQG6	0.365	0.322	1.335E-31	744	0.204	0.179	D3ZQG6.pdb.gz	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
5	AFDB:O70277	0.364	0.321	3.511E-31	744	0.227	0.199	O70277.pdb.gz	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
6	AFDB:E7F1U3	0.360	0.306	1.960E-30	774	0.225	0.190	E7F1U3.pdb.gz	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
7	AFDB:E7FAM5	0.358	0.287	2.818E-25	824	0.208	0.165	E7FAM5.pdb.gz	LIN41_DANRE E3 ubiquitin-protein ligase TRIM71 OS=Danio rerio OX=7955 GN=trim71 PE=1 SV=1
8	AFDB:Q2Q1W2	0.356	0.272	9.265E-24	868	0.207	0.156	Q2Q1W2.pdb.gz	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1
9	AFDB:Q03601	0.344	0.236	1.766E-23	974	0.222	0.149	Q03601.pdb.gz	NHL1_CAEEL RING finger protein nhl-1 OS=Caenorhabditis elegans OX=6239 GN=nhl-1 PE=1 SV=2
10	AFDB:M9PH32	0.361	0.203	4.645E-23	1206	0.193	0.104	M9PH32.pdb.gz	M9PH32_DROME Meiotic P26, isoform C OS=Drosophila melanogaster OX=7227 GN=mei-P26 PE=1 SV=1
11	PDB:2h9lA	0.283	0.524	8.104E-11	321	0.075	0.153	2h9lA.pdb.gz
12	PDB:5c2vB	0.290	0.496	2.505E-10	352	0.055	0.102	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
13	PDB:7aavG	0.316	0.594	8.170E-10	320	0.070	0.144	7aavG.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
14	PDB:5yzgs	0.289	0.472	1.557E-9	374	0.069	0.120	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:6bk8D	0.318	0.537	2.393E-9	359	0.057	0.103	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
16	PDB:6lqsB1	0.287	0.237	2.525E-9	806	0.052	0.042	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
17	PDB:5mzhB	0.274	0.403	2.812E-9	415	0.067	0.106	5mzhB.pdb.gz
18	PDB:3fm0A	0.301	0.554	3.131E-9	328	0.081	0.162	3fm0A.pdb.gz
19	PDB:4gn7A	0.322	0.651	4.096E-9	297	0.061	0.135	4gn7A.pdb.gz	Structural basis of the gamma-lactone-ring formation in ascorbic acid biosynthesis by the senescence marker protein-30/gluconolactonase
20	PDB:7ajtUO	0.301	0.384	4.096E-9	493	0.057	0.075	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IL45	0.0	876	663	0.643	0.633	A0A0R4IL45_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=3 SV=1
2	A8WGA9	0.0	874	663	0.643	0.633	A8WGA9_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=2 SV=1
3	Q13049	0.0	1345	653	1.000	1.000	TRI32_HUMAN E3 ubiquitin-protein ligase TRIM32 OS=Homo sapiens OX=9606 GN=TRIM32 PE=1 SV=2
4	Q8CH72	0.0	1298	655	0.962	0.959	TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus OX=10090 GN=Trim32 PE=1 SV=2
5	Q9C040	2.81e-26	116	744	0.262	0.230	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
6	Q9ESN6	6.01e-26	115	744	0.262	0.230	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
7	D3ZQG6	7.98e-26	115	744	0.259	0.227	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
8	F1QFW2	3.42e-16	84.7	744	0.136	0.120	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
9	Q58ER5	1.37e-15	82.8	744	0.135	0.118	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
10	O70277	6.62e-15	80.9	744	0.119	0.105	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
11	Q9R1R2	8.36e-15	80.5	744	0.118	0.103	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1
12	O75382	8.44e-15	80.5	744	0.118	0.103	TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2
13	B7YZK8	8.98e-15	80.9	1517	0.130	0.056	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
14	A0A0B4LFW8	1.03e-14	80.5	1277	0.129	0.066	A0A0B4LFW8_DROME Thin, isoform E OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
15	A0A0B4LFP7	1.08e-14	80.5	1248	0.129	0.067	A0A0B4LFP7_DROME Thin, isoform D OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
16	E7F1U3	1.13e-14	80.1	774	0.121	0.102	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
17	Q7JUV6	1.13e-14	80.5	1353	0.129	0.062	Q7JUV6_DROME GH06739p OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
18	P0CG21	1.66e-14	72.4	123	0.057	0.301	NHLC4_HUMAN NHL-repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=NHLRC4 PE=1 SV=1
19	Q6VVB1	2.12e-14	77.8	395	0.165	0.273	NHLC1_HUMAN E3 ubiquitin-protein ligase NHLRC1 OS=Homo sapiens OX=9606 GN=NHLRC1 PE=1 SV=2
20	Q2Q1W2	2.77e-14	79.0	868	0.118	0.089	LIN41_HUMAN E3 ubiquitin-protein ligase TRIM71 OS=Homo sapiens OX=9606 GN=TRIM71 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	0.29	22.5	Baculovirus immediate-early protein (IE-0)
2	PF15665 FAM184	1.2e+02	13.8	Family with sequence similarity 184, A and B
3	PF14376 Haem_bd	4.6e+02	12.2	Haem-binding domain
4	PF01436 NHL	1.7e-31	117.7	NHL repeat
5	PF14447 Prok-RING_4	0.99	20.6	Prokaryotic RING finger family 4
6	PF08450 SGL	2.8	19.1	SMP-30/Gluconolactonase/LRE-like region
7	PF00643 zf-B_box	2.1	19.9	B-box zinc finger
8	PF00097 zf-C3HC4	0.00071	30.7	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	0.13	23.5	Zinc finger, C3HC4 type (RING finger)
10	PF15227 zf-C3HC4_4	2.3	19.7	zinc finger of C3HC4-type, RING
11	PF11789 zf-Nse	7.5e+02	11.5	Zinc-finger of the MIZ type in Nse subunit
12	PF16685 zf-RING_10	62	15.1	zinc RING finger of MSL2
13	PF17123 zf-RING_11	18	16.5	RING-like zinc finger
14	PF13639 zf-RING_2	8.8e-06	37.3	Ring finger domain
15	PF14570 zf-RING_4	1.1	20.4	RING/Ubox like zinc-binding domain
16	PF14634 zf-RING_5	0.00036	31.8	zinc-RING finger domain
17	PF13445 zf-RING_UBOX	2.8e-07	41.8	RING-type zinc-finger
18	PF12760 Zn_Tnp_IS1595	1.9e+02	13.3	Transposase zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305161	0.970	E3 ubiquitin-protein ligase TRIM56
2	9606.ENSP00000362300	0.964	Protein argonaute-1
3	9606.ENSP00000316176	0.907	Ubiquitin-conjugating enzyme E2 N
4	9606.ENSP00000303709	0.877	Ubiquitin-conjugating enzyme E2 E1
5	9606.ENSP00000349722	0.868	Ubiquitin conjugating enzyme E2 D3
6	9606.ENSP00000363019	0.868	Ubiquitin-conjugating enzyme E2 D1
7	9606.ENSP00000262971	0.833	E3 SUMO-protein ligase PIAS4
8	9606.ENSP00000341680	0.828	Dysbindin
9	9606.ENSP00000316244	0.827	5-hydroxytryptamine receptor 1A
10	9606.ENSP00000295851	0.826	Abl interactor 2
11	9606.ENSP00000331288	0.811	Stimulator of interferon genes protein
12	9606.ENSP00000262366	0.786	Zinc finger protein GLIS2
13	9606.ENSP00000340305	0.778	Ubiquitin-conjugating enzyme E2 variant 1
14	9606.ENSP00000261707	0.758	Sodium-dependent serotonin transporter
15	9606.ENSP00000291539	0.755	High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
16	9606.ENSP00000295756	0.746	T-cell receptor-associated transmembrane adapter 1
17	9606.ENSP00000278282	0.740	Uteroglobin
18	9606.ENSP00000381717	0.740	Ubiquitin-conjugating enzyme E2 D2
19	9606.ENSP00000437737	0.731	5-hydroxytryptamine receptor 2A
20	9606.ENSP00000380349	0.730	Calpain-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061630	0.998	ubiquitin protein ligase activity
GO:0042802	0.995	identical protein binding
GO:0003676	0.920	nucleic acid binding
GO:0003723	0.405	RNA binding
GO:0140297	0.377	DNA-binding transcription factor binding
GO:0003713	0.375	transcription coactivator activity
GO:0061629	0.373	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0031369	0.347	translation initiation factor binding
GO:0017022	0.344	myosin binding
GO:0043621	0.315	protein self-association

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0048583	0.985	regulation of response to stimulus
GO:0032446	0.985	protein modification by small protein conjugation
GO:0009987	0.984	cellular process
GO:0023051	0.984	regulation of signaling
GO:0010646	0.984	regulation of cell communication
GO:0016567	0.981	protein ubiquitination
GO:0051091	0.966	positive regulation of DNA-binding transcription factor activity
GO:0051092	0.959	positive regulation of NF-kappaB transcription factor activity
GO:0009966	0.958	regulation of signal transduction
GO:0050896	0.949	response to stimulus
GO:0048584	0.948	positive regulation of response to stimulus
GO:0009967	0.939	positive regulation of signal transduction
GO:0016043	0.938	cellular component organization
GO:0000209	0.932	protein polyubiquitination
GO:0031331	0.926	positive regulation of cellular catabolic process
GO:0048523	0.915	negative regulation of cellular process
GO:1902533	0.911	positive regulation of intracellular signal transduction
GO:0051246	0.903	regulation of protein metabolic process
GO:0050792	0.899	regulation of viral process
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0010604	0.882	positive regulation of macromolecule metabolic process
GO:0051247	0.867	positive regulation of protein metabolic process
GO:0044237	0.849	cellular metabolic process
GO:0006950	0.825	response to stress
GO:0032501	0.808	multicellular organismal process
GO:0044419	0.805	biological process involved in interspecies interaction between organisms
GO:0009057	0.800	macromolecule catabolic process
GO:0009607	0.779	response to biotic stimulus
GO:0006952	0.708	defense response
GO:0019725	0.707	cellular homeostasis
GO:0044260	0.694	cellular macromolecule metabolic process
GO:0051707	0.687	response to other organism
GO:0040012	0.682	regulation of locomotion
GO:0051128	0.637	regulation of cellular component organization
GO:0001959	0.610	regulation of cytokine-mediated signaling pathway
GO:0042981	0.608	regulation of apoptotic process
GO:0051239	0.575	regulation of multicellular organismal process
GO:0001961	0.566	positive regulation of cytokine-mediated signaling pathway
GO:0032502	0.543	developmental process
GO:0009615	0.424	response to virus
GO:0051240	0.397	positive regulation of multicellular organismal process
GO:0043122	0.377	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048856	0.355	anatomical structure development
GO:0140546	0.343	defense response to symbiont
GO:0030163	0.339	protein catabolic process
GO:0051716	0.336	cellular response to stimulus
GO:2000145	0.321	regulation of cell motility
GO:0007275	0.318	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.992	cytosol
GO:0043232	0.875	intracellular non-membrane-bounded organelle
GO:0099080	0.661	supramolecular complex
GO:0099512	0.407	supramolecular fiber
GO:0016020	0.340	membrane
GO:0043292	0.321	contractile fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]