StarFunc result for job id Q13057

User Input

>input (564 residues)
MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQSSPVQA
TFEVLDFITHLYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQT
LDGSQYNPVKQQLVRYATSCYSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPV
AGSPKQPVRGYYRGAVGGTFDRLHNAHKVLLSVACILAQEQLVVGVADKDLLKSKLLPEL
LQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDPSLEFLVVSEETYRGGMAINR
FRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYERPELPTCLYV
IGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQ
NLVHEVWTAVIPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHI
TQRQVEKAWALLQKRIPKTHQALD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13057	1.000	1.000	0.000	564	1.000	1.000	Q13057.pdb.gz	COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4
2	AFDB:Q9DBL7	0.973	0.975	0.000	563	0.869	0.870	Q9DBL7.pdb.gz	COASY_MOUSE Bifunctional coenzyme A synthase OS=Mus musculus OX=10090 GN=Coasy PE=1 SV=2
3	AFDB:Q9VRP4	0.788	0.854	1.622E-52	518	0.353	0.384	Q9VRP4.pdb.gz	Q9VRP4_DROME Bifunctional phosphopantetheine adenylyltransferase - Dephospho-CoA kinase OS=Drosophila melanogaster OX=7227 GN=Ppat-Dpck PE=1 SV=2
4	AFDB:P53332	0.383	0.671	2.445E-21	305	0.138	0.256	P53332.pdb.gz	COAD_YEAST Phosphopantetheine adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB4 PE=1 SV=1
5	AFDB:Q10350	0.415	0.707	7.162E-19	316	0.131	0.234	Q10350.pdb.gz	YDA8_SCHPO Uncharacterized protein C1F12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F12.08 PE=4 SV=2
6	AFDB:Q8BHC4	0.325	0.745	4.317E-17	231	0.108	0.264	Q8BHC4.pdb.gz	DCAKD_MOUSE Dephospho-CoA kinase domain-containing protein OS=Mus musculus OX=10090 GN=Dcakd PE=1 SV=1
7	AFDB:Q8SWY7	0.335	0.773	6.896E-17	236	0.092	0.220	Q8SWY7.pdb.gz	Q8SWY7_DROME RH63365p OS=Drosophila melanogaster OX=7227 GN=Dpck PE=2 SV=1
8	AFDB:E5QCF8	0.341	0.747	1.476E-16	246	0.094	0.215	E5QCF8.pdb.gz	E5QCF8_CAEEL Dephospho-CoA kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_T05G5.5 PE=1 SV=1
9	AFDB:Q9ZQH0	0.340	0.797	2.224E-16	232	0.106	0.259	Q9ZQH0.pdb.gz	COAE_ARATH Dephospho-CoA kinase OS=Arabidopsis thaliana OX=3702 GN=COAE PE=1 SV=1
10	AFDB:Q03941	0.334	0.748	6.019E-16	241	0.103	0.241	Q03941.pdb.gz	CAB5_YEAST Dephospho-CoA kinase CAB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB5 PE=1 SV=1
11	PDB:1vhlA	0.289	0.695	1.871E-11	208	0.087	0.236	1vhlA.pdb.gz	Structural analysis of a set of proteins resulting from a bacterial genomics project
12	PDB:1t3hC	0.280	0.796	6.278E-10	187	0.069	0.209	1t3hC.pdb.gz
13	PDB:2c95A	0.222	0.568	1.486E-5	195	0.053	0.154	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
14	PDB:1ko5A	0.238	0.672	2.517E-5	172	0.057	0.186	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
15	PDB:1ukyA	0.226	0.582	3.000E-5	196	0.055	0.158	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
16	PDB:2cdnA	0.220	0.568	3.373E-5	186	0.048	0.145	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
17	PDB:2iyvA	0.209	0.548	3.792E-5	179	0.062	0.196	2iyvA.pdb.gz	Mechanism of Phosphoryl Transfer Catalyzed by Shikimate Kinase from Mycobacterium Tuberculosis.
18	PDB:4tmkA	0.222	0.496	9.126E-5	210	0.051	0.138	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.
19	PDB:1bifA	0.169	0.208	1.026E-4	432	0.060	0.079	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
20	PDB:2no0A	0.249	0.512	1.458E-4	242	0.046	0.107	2no0A.pdb.gz	Nonenantioselectivity Property of Human Deoxycytidine Kinase Explained by Structures of the Enzyme in Complex with l- and d-Nucleosides.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13057	0.0	1149	564	1.000	1.000	COASY_HUMAN Bifunctional coenzyme A synthase OS=Homo sapiens OX=9606 GN=COASY PE=1 SV=4
2	Q8MIR4	0.0	1035	562	0.902	0.906	COASY_PIG Bifunctional coenzyme A synthase OS=Sus scrofa OX=9823 GN=COASY PE=1 SV=1
3	Q9DBL7	0.0	1009	563	0.869	0.870	COASY_MOUSE Bifunctional coenzyme A synthase OS=Mus musculus OX=10090 GN=Coasy PE=1 SV=2
4	Q9VRP4	5.30e-104	325	518	0.298	0.324	Q9VRP4_DROME Bifunctional phosphopantetheine adenylyltransferase - Dephospho-CoA kinase OS=Drosophila melanogaster OX=7227 GN=Ppat-Dpck PE=1 SV=2
5	Q9ZPV8	5.91e-30	117	176	0.103	0.330	COAD_ARATH Phosphopantetheine adenylyltransferase OS=Arabidopsis thaliana OX=3702 GN=COAD PE=1 SV=1
6	P53332	7.90e-28	115	305	0.101	0.187	COAD_YEAST Phosphopantetheine adenylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB4 PE=1 SV=1
7	Q10350	7.11e-26	110	316	0.105	0.187	YDA8_SCHPO Uncharacterized protein C1F12.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F12.08 PE=4 SV=2
8	Q8BHC4	1.27e-23	101	231	0.108	0.264	DCAKD_MOUSE Dephospho-CoA kinase domain-containing protein OS=Mus musculus OX=10090 GN=Dcakd PE=1 SV=1
9	Q8WVC6	2.04e-23	101	231	0.110	0.268	DCAKD_HUMAN Dephospho-CoA kinase domain-containing protein OS=Homo sapiens OX=9606 GN=DCAKD PE=1 SV=1
10	Q8SWY7	5.48e-20	91.3	236	0.090	0.216	Q8SWY7_DROME RH63365p OS=Drosophila melanogaster OX=7227 GN=Dpck PE=2 SV=1
11	Q03941	9.07e-20	90.9	241	0.099	0.232	CAB5_YEAST Dephospho-CoA kinase CAB5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB5 PE=1 SV=1
12	Q9VI57	2.21e-19	89.7	236	0.090	0.216	Q9VI57_DROME Dephospho-CoA kinase OS=Drosophila melanogaster OX=7227 GN=Dpck PE=2 SV=1
13	P9WPA3	3.52e-19	92.0	407	0.117	0.162	COAE_MYCTU Dephospho-CoA kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=coaE PE=1 SV=1
14	Q9ZQH0	4.60e-19	88.6	232	0.099	0.241	COAE_ARATH Dephospho-CoA kinase OS=Arabidopsis thaliana OX=3702 GN=COAE PE=1 SV=1
15	Q381Q8	1.73e-18	87.8	268	0.106	0.224	Q381Q8_TRYB2 Cytidyltransferase-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6920 PE=4 SV=1
16	P34558	6.04e-17	82.8	237	0.083	0.198	YNP5_CAEEL Uncharacterized protein T05G5.5 OS=Caenorhabditis elegans OX=6239 GN=T05G5.5 PE=3 SV=2
17	O74414	2.05e-16	80.9	236	0.087	0.208	YJL1_SCHPO Uncharacterized protein C14G10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC14G10.01 PE=1 SV=1
18	E5QCF8	2.33e-16	81.3	246	0.083	0.191	E5QCF8_CAEEL Dephospho-CoA kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_T05G5.5 PE=1 SV=1
19	E5QCF6	2.74e-16	80.5	227	0.082	0.203	E5QCF6_CAEEL Dephospho-CoA kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_T05G5.5 PE=1 SV=1
20	P0A6I9	4.39e-14	73.6	206	0.057	0.155	COAE_ECOLI Dephospho-CoA kinase OS=Escherichia coli (strain K12) OX=83333 GN=coaE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13238 AAA_18	12	17.9	AAA domain
2	PF13671 AAA_33	0.27	22.8	AAA domain
3	PF01583 APS_kinase	1.9e+02	13.4	Adenylylsulphate kinase
4	PF01121 CoaE	5.7e-37	138.6	Dephospho-CoA kinase
5	PF01467 CTP_transf_like	4.4e-05	35.1	Cytidylyltransferase-like
6	PF00485 PRK	3e+02	12.6	Phosphoribulokinase / Uridine kinase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464814

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343190	0.997	Phosphopantothenoylcysteine decarboxylase
2	9606.ENSP00000313377	0.988	Pantothenate kinase 2, mitochondrial
3	9606.ENSP00000302108	0.986	Pantothenate kinase 1
4	9606.ENSP00000239231	0.981	Pantothenate kinase 3
5	9606.ENSP00000225577	0.929	Ribosomal protein S6 kinase beta-1
6	9606.ENSP00000361642	0.926	Phosphopantothenate--cysteine ligase
7	9606.ENSP00000278618	0.924	L-aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
8	9606.ENSP00000358414	0.905	Hydroxymethylglutaryl-CoA synthase, mitochondrial
9	9606.ENSP00000354238	0.904	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
10	9606.ENSP00000406261	0.904	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
11	9606.ENSP00000367727	0.806	Pantothenate kinase 4
12	9606.ENSP00000364404	0.780	DDB1- and CUL4-associated factor 17
13	9606.ENSP00000322706	0.770	Hydroxymethylglutaryl-CoA synthase, cytoplasmic
14	9606.ENSP00000419851	0.753	GMP synthase [glutamine-hydrolyzing]
15	9606.ENSP00000246337	0.739	Uroporphyrinogen decarboxylase
16	9606.ENSP00000381461	0.728	Protein phosphatase methylesterase 1
17	9606.ENSP00000278353	0.718	Very-long-chain 3-oxoacyl-CoA reductase
18	9606.ENSP00000236959	0.705	Bifunctional purine biosynthesis protein PURH
19	9606.ENSP00000322991	0.692	Branched-chain-amino-acid aminotransferase, mitochondrial
20	9606.ENSP00000367923	0.680	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004595	1.000	pantetheine-phosphate adenylyltransferase activity
GO:0004140	1.000	dephospho-CoA kinase activity
GO:0005515	0.986	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015936	0.998	coenzyme A metabolic process
GO:0034030	0.998	ribonucleoside bisphosphate biosynthetic process
GO:0009152	0.998	purine ribonucleotide biosynthetic process
GO:0034033	0.996	purine nucleoside bisphosphate biosynthetic process
GO:0015937	0.576	coenzyme A biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005739	0.999	mitochondrion
GO:0005615	0.997	extracellular space
GO:0031090	0.997	organelle membrane
GO:1903561	0.996	extracellular vesicle
GO:0098588	0.993	bounding membrane of organelle
GO:0070062	0.992	extracellular exosome
GO:0031966	0.989	mitochondrial membrane
GO:0005759	0.981	mitochondrial matrix
GO:0031968	0.975	organelle outer membrane
GO:0005741	0.950	mitochondrial outer membrane
GO:0005829	0.927	cytosol
GO:0005634	0.352	nucleus
GO:0031981	0.315	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19801	1.000	(R)-4'-phosphopantetheine + ATP + H(+) = 3'-dephospho-CoA + diphosphate
RHEA:18245	1.000	3'-dephospho-CoA + ATP = ADP + CoA + H(+)
EC:2.7.7.3	1.000	pantetheine-phosphate adenylyltransferase.
EC:2.7.1.24	1.000	dephospho-CoA kinase.

[back to server]