StarFunc result for job id Q13075

User Input

>input (1403 residues)
MATQQKASDERISQFDHNLLPELSALLGLDAVQLAKELEEEEQKERAKMQKGYNSQMRSE
AKRLKTFVTYEPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRF
HPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCV
LSEAGFVFTGKQDTVQCFSCGGCLGNWEEGDDPWKEHAKWFPKCEFLRSKKSSEEITQYI
QSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEELRLDSFKDWPRESAVGVAALA
KAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKSSAEVTPDLQS
RGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS
LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLL
KKIAFLWASGCCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCVRNIIQ
QLKNQVLFLLDDYKEICSIPQVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIK
AFPFYNTVCILRKLFSHNMTRLRKFMVYFGKNQSLQKIQKTPLFVAAICAHWFQYPFDPS
FDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGFFSCCFEFNDDDLAEAGVDED
EDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDLGLYHLKQINS
PMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ
MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNL
QYFFDHPESLSLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEW
ERNLAEKEDNVKSYMDMQRRASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEIL
MTVFSASQRIELHLNHSRGFIESIRPALELSKASVTKCSISKLELSAAEQELLLTLPSLE
SLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSVIPEEFPNFHHMEKLLIQISA
EYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSDSFFQAVPFVA
SLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQ
QLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNM
PNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKER
HPQSKYLTILQKWILPFSPIIQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0R915	0.915	0.915	0.000	1403	0.679	0.679	M0R915.pdb.gz	M0R915_RAT NLR family, apoptosis inhibitory protein 6 OS=Rattus norvegicus OX=10116 GN=Naip6 PE=4 SV=3
2	AFDB:Q13075	1.000	1.000	0.000	1403	1.000	1.000	Q13075.pdb.gz	BIRC1_HUMAN Baculoviral IAP repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NAIP PE=1 SV=3
3	AFDB:Q9JIB6	0.934	0.934	0.000	1403	0.662	0.662	Q9JIB6.pdb.gz	BIR1F_MOUSE Baculoviral IAP repeat-containing protein 1f OS=Mus musculus OX=10090 GN=Naip6 PE=1 SV=2
4	AFDB:Q9QUK4	0.899	0.873	0.000	1447	0.674	0.653	Q9QUK4.pdb.gz	BIR1B_MOUSE Baculoviral IAP repeat-containing protein 1b OS=Mus musculus OX=10090 GN=Naip2 PE=1 SV=2
5	AFDB:Q9QWK5	0.945	0.945	0.000	1403	0.683	0.683	Q9QWK5.pdb.gz	BIR1A_MOUSE Baculoviral IAP repeat-containing protein 1a OS=Mus musculus OX=10090 GN=Naip1 PE=2 SV=3
6	PDB:6b5bA	0.684	0.796	4.464E-84	1199	0.582	0.681	6b5bA.pdb.gz
7	PDB:5yudA	0.805	0.907	1.705E-82	1238	0.573	0.649	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
8	AFDB:Q9NPP4	0.391	0.521	6.458E-43	1024	0.159	0.218	Q9NPP4.pdb.gz	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
9	AFDB:Q3UP24	0.363	0.475	1.735E-40	1024	0.152	0.208	Q3UP24.pdb.gz	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
10	PDB:4kxfP	0.362	0.553	2.333E-35	866	0.146	0.237	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
11	PDB:3jblA	0.499	0.740	1.180E-28	909	0.157	0.242	3jblA.pdb.gz
12	AFDB:Q5DU56	0.236	0.300	2.929E-21	1064	0.121	0.160	Q5DU56.pdb.gz	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
13	AFDB:D4A523	0.228	0.292	6.973E-21	1035	0.126	0.171	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
14	AFDB:Q96MN2	0.205	0.273	1.026E-19	994	0.118	0.167	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
15	PDB:7pzcA	0.177	0.235	1.264E-14	1010	0.111	0.154	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
16	PDB:7lfhA	0.172	0.260	2.630E-13	806	0.115	0.200	7lfhA.pdb.gz
17	PDB:6npyA	0.173	0.268	3.721E-13	798	0.112	0.197	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
18	PDB:6j5wA	0.132	0.190	3.953E-7	816	0.071	0.121	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
19	PDB:2p1nB	0.216	0.477	4.502E-7	571	0.051	0.126	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
20	PDB:3oglB	0.204	0.436	8.627E-7	568	0.058	0.143	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZWN7	0.0	1808	1358	0.641	0.662	A0A8I5ZWN7_RAT NLR family, apoptosis inhibitory protein 6 OS=Rattus norvegicus OX=10116 GN=Naip6 PE=4 SV=1
2	M0R915	0.0	1922	1414	0.672	0.667	M0R915_RAT NLR family, apoptosis inhibitory protein 6 OS=Rattus norvegicus OX=10116 GN=Naip6 PE=4 SV=3
3	Q13075	0.0	2904	1403	1.000	1.000	BIRC1_HUMAN Baculoviral IAP repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NAIP PE=1 SV=3
4	Q9JIB6	0.0	1900	1403	0.663	0.663	BIR1F_MOUSE Baculoviral IAP repeat-containing protein 1f OS=Mus musculus OX=10090 GN=Naip6 PE=1 SV=2
5	Q9QUK4	0.0	1930	1447	0.674	0.653	BIR1B_MOUSE Baculoviral IAP repeat-containing protein 1b OS=Mus musculus OX=10090 GN=Naip2 PE=1 SV=2
6	Q9QWK5	0.0	1965	1403	0.684	0.684	BIR1A_MOUSE Baculoviral IAP repeat-containing protein 1a OS=Mus musculus OX=10090 GN=Naip1 PE=2 SV=3
7	Q9R016	0.0	1917	1403	0.675	0.675	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e OS=Mus musculus OX=10090 GN=Naip5 PE=1 SV=3
8	Q9NPP4	5.09e-52	202	1024	0.168	0.230	NLRC4_HUMAN NLR family CARD domain-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRC4 PE=1 SV=2
9	Q3UP24	2.83e-47	187	1024	0.167	0.229	NLRC4_MOUSE NLR family CARD domain-containing protein 4 OS=Mus musculus OX=10090 GN=Nlrc4 PE=1 SV=1
10	A0A8I6ADV9	4.94e-43	168	537	0.083	0.216	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1
11	Q6P6S1	2.27e-42	167	589	0.083	0.197	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
12	Q13490	1.88e-41	165	618	0.083	0.188	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
13	Q62210	6.13e-41	163	612	0.077	0.176	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
14	F7FLN8	1.20e-39	159	602	0.078	0.181	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
15	Q5XIW4	1.33e-39	159	602	0.078	0.181	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
16	A0A0G2JTI9	1.86e-39	159	638	0.085	0.187	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
17	Q13489	9.20e-39	156	604	0.078	0.182	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
18	Q60989	9.75e-39	154	496	0.084	0.238	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
19	O08863	1.24e-37	153	600	0.073	0.172	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
20	H0YZU0	5.77e-37	149	485	0.076	0.221	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4.7e+02	12.6	ATPase family associated with various cellular activities (AAA)
2	PF13401 AAA_22	82	14.9	AAA domain
3	PF13604 AAA_30	35	15.6	AAA domain
4	PF00653 BIR	2.9e-52	186.5	Inhibitor of Apoptosis domain
5	PF09848 DUF2075	2.7e+02	12.2	Schlafen group 3, DNA/RNA helicase domain
6	PF12799 LRR_4	11	17.8	Leucine Rich repeats (2 copies)
7	PF05729 NACHT	8.1e-35	131.7	NACHT domain
8	PF00931 NB-ARC	1.4	19.6	NB-ARC domain
9	PF17889 NLRC4_HD	4.3e-40	147.8	NLRC4 helical domain
10	PF17779 NOD2_WH	0.0018	29.8	NOD2 winged helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428657

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385090	0.978	NLR family CARD domain-containing protein 4
2	9606.ENSP00000362566	0.960	Neuron-specific calcium-binding protein hippocalcin
3	9606.ENSP00000433138	0.925	Caspase-1
4	9606.ENSP00000337383	0.899	NACHT, LRR and PYD domains-containing protein 3
5	9606.ENSP00000357112	0.865	Interferon-inducible protein AIM2
6	9606.ENSP00000309767	0.854	NACHT, LRR and PYD domains-containing protein 6
7	9606.ENSP00000301295	0.852	NACHT, LRR and PYD domains-containing protein 4
8	9606.ENSP00000376849	0.822	Caspase-5
9	9606.ENSP00000247470	0.810	Apoptosis-associated speck-like protein containing a CARD
10	9606.ENSP00000485010	0.804	MHC class II transactivator
11	9606.ENSP00000433209	0.780	Gasdermin-D
12	9606.ENSP00000398495	0.779	Diablo homolog, mitochondrial
13	9606.ENSP00000330237	0.751	Caspase-9
14	9606.ENSP00000375767	0.728	Caspase recruitment domain-containing protein 8
15	9606.ENSP00000346892	0.727	Small EDRK-rich factor 1A
16	9606.ENSP00000370126	0.727	Small EDRK-rich factor 1B
17	9606.ENSP00000388566	0.721	Caspase-4
18	9606.ENSP00000219596	0.719	Pyrin
19	9606.ENSP00000448165	0.704	Apoptotic protease-activating factor 1
20	9606.ENSP00000370119	0.701	Survival motor neuron protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0019900	0.895	kinase binding
GO:0000166	0.895	nucleotide binding
GO:0005524	0.887	ATP binding
GO:0019901	0.815	protein kinase binding
GO:0043028	0.517	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0120283	0.447	protein serine/threonine kinase binding
GO:0061134	0.356	peptidase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0009987	0.986	cellular process
GO:0050789	0.979	regulation of biological process
GO:0008219	0.963	cell death
GO:0050794	0.956	regulation of cellular process
GO:0012501	0.945	programmed cell death
GO:0048583	0.918	regulation of response to stimulus
GO:0052547	0.918	regulation of peptidase activity
GO:0052548	0.899	regulation of endopeptidase activity
GO:0006950	0.898	response to stress
GO:0010033	0.890	response to organic substance
GO:0048518	0.860	positive regulation of biological process
GO:0048522	0.852	positive regulation of cellular process
GO:0048519	0.797	negative regulation of biological process
GO:2000116	0.796	regulation of cysteine-type endopeptidase activity
GO:0051716	0.776	cellular response to stimulus
GO:0048523	0.762	negative regulation of cellular process
GO:0010941	0.746	regulation of cell death
GO:0009605	0.711	response to external stimulus
GO:0010604	0.707	positive regulation of macromolecule metabolic process
GO:0009607	0.701	response to biotic stimulus
GO:0023051	0.692	regulation of signaling
GO:0010646	0.692	regulation of cell communication
GO:0098542	0.687	defense response to other organism
GO:0009611	0.683	response to wounding
GO:0071310	0.683	cellular response to organic substance
GO:0009617	0.682	response to bacterium
GO:0009595	0.647	detection of biotic stimulus
GO:0043067	0.635	regulation of programmed cell death
GO:0042742	0.630	defense response to bacterium
GO:0010468	0.621	regulation of gene expression
GO:0009966	0.619	regulation of signal transduction
GO:0080134	0.612	regulation of response to stress
GO:0048584	0.608	positive regulation of response to stimulus
GO:0098581	0.600	detection of external biotic stimulus
GO:0006954	0.599	inflammatory response
GO:0009719	0.597	response to endogenous stimulus
GO:0060548	0.576	negative regulation of cell death
GO:0071495	0.575	cellular response to endogenous stimulus
GO:0044092	0.571	negative regulation of molecular function
GO:0001817	0.566	regulation of cytokine production
GO:0043281	0.565	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0042981	0.560	regulation of apoptotic process
GO:0001819	0.522	positive regulation of cytokine production
GO:0009892	0.489	negative regulation of metabolic process
GO:0043086	0.468	negative regulation of catalytic activity
GO:0043627	0.465	response to estrogen
GO:1902531	0.464	regulation of intracellular signal transduction
GO:0043069	0.463	negative regulation of programmed cell death
GO:0071391	0.462	cellular response to estrogen stimulus
GO:0009967	0.451	positive regulation of signal transduction
GO:0051346	0.448	negative regulation of hydrolase activity
GO:0048678	0.447	response to axon injury
GO:0045861	0.446	negative regulation of proteolysis
GO:0010466	0.439	negative regulation of peptidase activity
GO:1902533	0.434	positive regulation of intracellular signal transduction
GO:0006915	0.428	apoptotic process
GO:0043066	0.376	negative regulation of apoptotic process
GO:0060759	0.372	regulation of response to cytokine stimulus
GO:0032501	0.369	multicellular organismal process
GO:0032652	0.336	regulation of interleukin-1 production
GO:2000117	0.330	negative regulation of cysteine-type endopeptidase activity
GO:0051173	0.314	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.998	protein-containing complex
GO:0061702	0.911	inflammasome complex
GO:0016020	0.890	membrane
GO:0043229	0.814	intracellular organelle
GO:0043231	0.790	intracellular membrane-bounded organelle
GO:0071944	0.751	cell periphery
GO:0005886	0.733	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]