StarFunc result for job id Q13077

User Input

>input (416 residues)
MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGE
DLQSISPGSRLRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLL
GFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQH
FMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQ
QTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPAFYTAK
YGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAID
AFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13077	1.000	1.000	5.794E-75	416	1.000	1.000	Q13077.pdb.gz	TRAF1_HUMAN TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1
2	AFDB:P39428	0.689	0.700	1.562E-62	409	0.844	0.858	P39428.pdb.gz	TRAF1_MOUSE TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2
3	AFDB:A0A024R8H5	0.539	0.451	1.957E-34	501	0.339	0.281	A0A024R8H5.pdb.gz
4	AFDB:P39429	0.509	0.426	2.630E-34	501	0.339	0.281	P39429.pdb.gz	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
5	AFDB:O00463	0.461	0.349	3.370E-31	557	0.279	0.208	O00463.pdb.gz	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
6	AFDB:Q13114	0.414	0.304	5.099E-31	568	0.303	0.222	Q13114.pdb.gz	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
7	AFDB:Q6DEG0	0.433	0.317	1.478E-30	573	0.310	0.225	Q6DEG0.pdb.gz	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
8	AFDB:P70191	0.450	0.342	2.236E-30	558	0.291	0.217	P70191.pdb.gz	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
9	AFDB:Q9Y4K3	0.362	0.293	1.629E-20	522	0.195	0.155	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
10	AFDB:Q6DJN2	0.387	0.296	1.729E-20	556	0.185	0.138	Q6DJN2.pdb.gz	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
11	PDB:3t6qC	0.121	0.266	9.570E-2	139	0.024	0.072	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
12	PDB:6xwvD	0.076	0.157	1.143E-1	123	0.048	0.163	6xwvD.pdb.gz	Structural basis for centromere maintenance by Drosophila CENP-A chaperone CAL1.
13	PDB:6xwuA	0.068	0.136	1.212E-1	138	0.031	0.094	6xwuA.pdb.gz
14	PDB:4lejA	0.089	0.100	1.946E-1	355	0.026	0.031	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.
15	PDB:3wsoA	0.103	0.146	2.064E-1	252	0.038	0.063	3wsoA.pdb.gz
16	PDB:3b2dC	0.134	0.286	2.324E-1	139	0.029	0.086	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:7wrgA	0.117	0.074	2.465E-1	812	0.026	0.014	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
18	PDB:3mguA	0.093	0.078	2.944E-1	533	0.029	0.023	3mguA.pdb.gz	Structural and functional insights into S. cerevisiae Tpa1, a putative prolyl hydroxylase influencing translation termination and transcription
19	PDB:5nikD	0.117	0.136	2.944E-1	340	0.031	0.038	5nikD.pdb.gz
20	PDB:6oj0A	0.097	0.176	3.957E-1	178	0.053	0.124	6oj0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P39428	0.0	719	409	0.844	0.858	TRAF1_MOUSE TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2
2	Q13077	0.0	861	416	1.000	1.000	TRAF1_HUMAN TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1
3	Q4VA12	0.0	711	409	0.837	0.851	Q4VA12_MOUSE TNF receptor-associated factor OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=1
4	P39429	7.81e-89	280	501	0.365	0.303	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
5	Q12933	2.52e-88	278	501	0.380	0.315	TRAF2_HUMAN TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2
6	B5DFH7	3.72e-86	273	497	0.349	0.292	B5DFH7_RAT TNF receptor-associated factor OS=Rattus norvegicus OX=10116 GN=Traf2 PE=1 SV=1
7	Q13114	8.19e-72	237	568	0.361	0.264	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
8	Q60803	2.85e-71	236	567	0.361	0.265	TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2
9	Q6DEG0	1.47e-68	229	573	0.344	0.250	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
10	P70191	2.56e-62	212	558	0.341	0.254	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
11	O00463	3.26e-62	212	557	0.341	0.255	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
12	Q7T1K2	7.28e-33	130	470	0.163	0.145	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
13	Q9BUZ4	1.16e-32	130	470	0.171	0.151	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1
14	Q61382	3.16e-32	129	470	0.166	0.147	TRAF4_MOUSE TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2
15	Q9UAC5	5.71e-30	122	412	0.163	0.165	Q9UAC5_DROME TRAF1 OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=2 SV=1
16	Q9XYR0	8.41e-30	122	486	0.163	0.140	Q9XYR0_DROME LD20987p OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=1 SV=1
17	A8DYU9	8.79e-30	122	477	0.163	0.143	A8DYU9_DROME TNF-receptor-associated factor 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Traf4 PE=4 SV=2
18	Q6IWL4	7.51e-26	111	542	0.238	0.183	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
19	P70196	5.31e-25	109	530	0.163	0.128	TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2
20	B5DF45	8.12e-25	108	530	0.192	0.151	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04065 Not3	5.2e+02	11.4	Not1 N-terminal domain, CCR4-Not complex component
2	PF13675 PilJ	3.6e+02	12.6	Type IV pili methyl-accepting chemotaxis transducer N-term
3	PF16673 TRAF_BIRC3_bd	1e-12	58.9	TNF receptor-associated factor BIRC3 binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362994

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263464	0.999	Baculoviral IAP repeat-containing protein 3
2	9606.ENSP00000361359	0.999	Tumor necrosis factor receptor superfamily member 5
3	9606.ENSP00000365435	0.999	Tumor necrosis factor receptor superfamily member 1B
4	9606.ENSP00000376505	0.999	TRAF family member-associated NF-kappa-B activator
5	9606.ENSP00000477613	0.999	Baculoviral IAP repeat-containing protein 2
6	9606.ENSP00000247668	0.998	TNF receptor-associated factor 2
7	9606.ENSP00000162749	0.996	Tumor necrosis factor receptor superfamily member 1A
8	9606.ENSP00000341268	0.996	Tumor necrosis factor receptor type 1-associated DEATH domain protein
9	9606.ENSP00000478699	0.993	Tumor necrosis factor receptor superfamily member 9
10	9606.ENSP00000481570	0.992	Tumor necrosis factor alpha-induced protein 3
11	9606.ENSP00000351273	0.988	Caspase-8
12	9606.ENSP00000259808	0.984	Receptor-interacting serine/threonine-protein kinase 1
13	9606.ENSP00000482657	0.983	Mitogen-activated protein kinase kinase kinase 14
14	9606.ENSP00000312455	0.969	CASP8 and FADD-like apoptosis regulator
15	9606.ENSP00000398698	0.969	Tumor necrosis factor
16	9606.ENSP00000351908	0.968	Mitogen-activated protein kinase kinase kinase 5
17	9606.ENSP00000359663	0.966	CD40 ligand
18	9606.ENSP00000216797	0.964	NF-kappa-B inhibitor alpha
19	9606.ENSP00000263932	0.962	Tumor necrosis factor receptor superfamily member 8
20	9606.ENSP00000312664	0.959	Caspase-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.992	enzyme binding
GO:0005102	0.978	signaling receptor binding
GO:0042802	0.962	identical protein binding
GO:0005126	0.886	cytokine receptor binding
GO:0044389	0.879	ubiquitin-like protein ligase binding
GO:0032813	0.877	tumor necrosis factor receptor superfamily binding
GO:0031625	0.871	ubiquitin protein ligase binding
GO:0005164	0.721	tumor necrosis factor receptor binding
GO:0031996	0.358	thioesterase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0009987	0.990	cellular process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0009966	0.971	regulation of signal transduction
GO:0065009	0.956	regulation of molecular function
GO:0051090	0.947	regulation of DNA-binding transcription factor activity
GO:0051091	0.924	positive regulation of DNA-binding transcription factor activity
GO:0051092	0.912	positive regulation of NF-kappaB transcription factor activity
GO:2001233	0.901	regulation of apoptotic signaling pathway
GO:0048518	0.837	positive regulation of biological process
GO:2001236	0.834	regulation of extrinsic apoptotic signaling pathway
GO:0050896	0.830	response to stimulus
GO:0048522	0.806	positive regulation of cellular process
GO:0051716	0.734	cellular response to stimulus
GO:0071840	0.697	cellular component organization or biogenesis
GO:0009893	0.588	positive regulation of metabolic process
GO:0016043	0.574	cellular component organization
GO:0007154	0.562	cell communication
GO:0010604	0.552	positive regulation of macromolecule metabolic process
GO:0048519	0.548	negative regulation of biological process
GO:0023052	0.527	signaling
GO:0007165	0.499	signal transduction
GO:0048584	0.426	positive regulation of response to stimulus
GO:0043933	0.416	protein-containing complex organization
GO:0071704	0.406	organic substance metabolic process
GO:0044238	0.397	primary metabolic process
GO:0048523	0.377	negative regulation of cellular process
GO:0051173	0.377	positive regulation of nitrogen compound metabolic process
GO:1902531	0.376	regulation of intracellular signal transduction
GO:0006807	0.345	nitrogen compound metabolic process
GO:0042221	0.332	response to chemical
GO:0044085	0.323	cellular component biogenesis
GO:0051246	0.315	regulation of protein metabolic process
GO:0043170	0.314	macromolecule metabolic process
GO:0031325	0.310	positive regulation of cellular metabolic process
GO:1902533	0.307	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.952	organelle
GO:0043229	0.918	intracellular organelle
GO:0016020	0.917	membrane
GO:0043227	0.916	membrane-bounded organelle
GO:0043231	0.795	intracellular membrane-bounded organelle
GO:0032991	0.675	protein-containing complex
GO:0005886	0.673	plasma membrane
GO:0012505	0.497	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]