StarFunc result for job id Q13085

User Input

>input (2346 residues)
MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLS
DLGISSLQDGLALHIRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGYVKDVDDGLQA
AEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILADQYGNAISLFGRDCSVQRRHQKIIEEAPATIATPAVFEHMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMY
GVSPWGDSPIDFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQMNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYA
EIEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVLAKMQLDNPSKVQQAELHTGSLPRIQ
STALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSD
MNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRM
SFSSNLNHYGMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDSP
PQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFREFTQQNKATLV
DHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQ
LELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFE
YLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYG
SRLWKLRVLQAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQA
YGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQA
FLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMTFKSPEYPEGRDIIVI
GNDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVSANSGARIGLAEEIRHMFHVAWVD
PEDPYKGYRYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGIGPENLRGS
GMIAGESSLAYNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGR
EVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKDPID
RIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGG
IPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPL
MVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSI
NPRHMEMYADRESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAE
RKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKTSRTFFYWRLR
RLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLAEWLEKQLTE
EDGVHSVIEENIKCISRDYVLKQIRSLVQANPEVAMDSIIHMTQHISPTQRAEVIRILST
MDSPST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5cskA	0.791	0.924	0.000	1996	0.403	0.473	5cskA.pdb.gz
2	PDB:5cskB	0.777	0.897	0.000	2017	0.403	0.469	5cskB.pdb.gz
3	PDB:5cslA	0.809	0.922	0.000	2050	0.416	0.477	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
4	PDB:5cslB	0.800	0.901	0.000	2072	0.415	0.470	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
5	PDB:6g2dC	0.857	0.945	0.000	2121	0.902	0.998	6g2dC.pdb.gz
6	PDB:6g2iA	0.341	0.375	0.000	2080	0.881	0.994	6g2iA.pdb.gz
7	AFDB:A1Z784	0.919	0.870	0.000	2482	0.613	0.579	A1Z784.pdb.gz	A1Z784_DROME acetyl-CoA carboxylase OS=Drosophila melanogaster OX=7227 GN=ACC PE=1 SV=1
8	AFDB:F1QH12	0.944	0.927	0.000	2390	0.870	0.854	F1QH12.pdb.gz
9	AFDB:F4I1L3	0.856	0.852	0.000	2355	0.380	0.378	F4I1L3.pdb.gz	ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=ACC2 PE=2 SV=1
10	AFDB:H2L0M0	0.728	0.784	0.000	2165	0.311	0.337	H2L0M0.pdb.gz	H2L0M0_CAEEL acetyl-CoA carboxylase OS=Caenorhabditis elegans OX=6239 GN=pod-2 PE=1 SV=1
11	AFDB:O00763	0.944	0.901	0.000	2458	0.747	0.713	O00763.pdb.gz	ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB PE=1 SV=3
12	AFDB:P11029	0.942	0.950	0.000	2324	0.923	0.932	P11029.pdb.gz	ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus OX=9031 GN=ACAC PE=1 SV=1
13	AFDB:P78820	0.886	0.912	0.000	2280	0.443	0.456	P78820.pdb.gz	ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut6 PE=1 SV=2
14	AFDB:Q00955	0.832	0.872	0.000	2233	0.428	0.450	Q00955.pdb.gz	ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACC1 PE=1 SV=2
15	AFDB:Q13085	1.000	1.000	0.000	2346	1.000	1.000	Q13085.pdb.gz	ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2
16	AFDB:Q54J08	0.853	0.875	0.000	2282	0.423	0.435	Q54J08.pdb.gz	ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum OX=44689 GN=accA PE=3 SV=1
17	PDB:6g2hA	0.271	0.711	8.899E-87	761	0.321	0.989	6g2hA.pdb.gz
18	PDB:3n6rG	0.189	0.602	5.183E-46	646	0.081	0.293	3n6rG.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
19	PDB:4rcnB	0.184	0.406	4.636E-42	1000	0.111	0.260	4rcnB.pdb.gz
20	PDB:3u9sA	0.198	0.684	6.760E-42	621	0.074	0.280	3u9sA.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1F2	3589	2476	0.731	0.693	A0A0G2K1F2_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=2
2	A0A0G2K5L6	3597	2462	0.732	0.697	A0A0G2K5L6_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=2
3	A0A2R8QJA0	4216	2375	0.867	0.856	A0A2R8QJA0_DANRE acetyl-CoA carboxylase OS=Danio rerio OX=7955 GN=acc PE=1 SV=1
4	A0A8I6ART3	3578	2277	0.725	0.747	A0A8I6ART3_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=1
5	A1Z784	2918	2482	0.609	0.575	A1Z784_DROME acetyl-CoA carboxylase OS=Drosophila melanogaster OX=7227 GN=ACC PE=1 SV=1
6	A8DY67	2913	2348	0.606	0.606	A8DY67_DROME acetyl-CoA carboxylase OS=Drosophila melanogaster OX=7227 GN=ACC PE=1 SV=2
7	B7G7S4	709	2092	0.155	0.174	B7G7S4_PHATC acetyl-CoA carboxylase OS=Phaeodactylum tricornutum (strain CCAP 1055/1) OX=556484 GN=ACC1 PE=4 SV=1
8	D3ZBE2	3455	2459	0.714	0.681	D3ZBE2_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=4
9	E9PSQ0	3481	2460	0.716	0.683	E9PSQ0_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=1 SV=2
10	E9Q4Z2	3603	2448	0.735	0.705	ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus OX=10090 GN=Acacb PE=1 SV=1
11	F4I1L3	1579	2355	0.380	0.379	ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=ACC2 PE=2 SV=1
12	F6P055	4259	2383	0.872	0.859	F6P055_DANRE acetyl-CoA carboxylase OS=Danio rerio OX=7955 GN=acc PE=1 SV=1
13	G3H9D1	3161	1579	0.653	0.970	G3H9D1_CRIGR Acetyl-CoA carboxylase 1 OS=Cricetulus griseus OX=10029 GN=I79_006999 PE=1 SV=1
14	H2L0M0	642	2165	0.147	0.160	H2L0M0_CAEEL acetyl-CoA carboxylase OS=Caenorhabditis elegans OX=6239 GN=pod-2 PE=1 SV=1
15	O00763	3660	2458	0.747	0.713	ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB PE=1 SV=3
16	O70151	3444	2456	0.710	0.678	O70151_RAT acetyl-CoA carboxylase OS=Rattus norvegicus OX=10116 GN=Acacb PE=2 SV=1
17	P11029	4534	2324	0.924	0.932	ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus OX=9031 GN=ACAC PE=1 SV=1
18	P11497	4777	2345	0.974	0.974	ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus OX=10116 GN=Acaca PE=1 SV=1
19	P32874	1744	2273	0.398	0.411	HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFA1 PE=1 SV=2
20	P78820	1980	2280	0.448	0.461	ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08326 ACC_central	3.9e-271	913.2	Acetyl-CoA carboxylase, central region
2	PF02222 ATP-grasp	0.014	26.5	ATP-grasp domain
3	PF02655 ATP-grasp_3	0.13	23.8	ATP-grasp domain
4	PF02785 Biotin_carb_C	1.7e-19	81.2	Biotin carboxylase C-terminal domain
5	PF00289 Biotin_carb_N	5e-28	109.2	Biotin carboxylase, N-terminal domain
6	PF00364 Biotin_lipoyl	6.1e-14	62.9	Biotin-requiring enzyme
7	PF01039 Carboxyl_trans	5.3e-182	617.5	Carboxyl transferase domain
8	PF02786 CPSase_L_D2	7.9e-51	184.1	Carbamoyl-phosphate synthase L chain, ATP binding domain
9	PF07478 Dala_Dala_lig_C	0.011	26.8	D-ala D-ala ligase C-terminus
10	PF16371 MetallophosN	5.8e+02	12.1	N terminal of Calcineurin-like phosphoesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000053011

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000016660	0.995	Fatty acid synthase
2	9598.ENSPTRP00000015727	0.984	E3 ubiquitin-protein ligase that specifically mediates the formation of 'Lys-6'-linked polyubiquitin chains and plays a central role in DNA repair by facilitating cellular responses to DNA damage. It is unclear whether it also mediates the formation of other types of polyubiquitin chains. The E3 ubiquitin-protein ligase activity is required for its tumor suppressor function. The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. Regulates centrosomal microtubule [...]
3	9598.ENSPTRP00000048213	0.982	Non-specific serine/threonine protein kinase
4	9598.ENSPTRP00000009195	0.976	Uncharacterized protein
5	9598.ENSPTRP00000024925	0.975	Malonyl CoA:ACP acyltransferase (Mitochondrial)
6	9598.ENSPTRP00000044752	0.974	Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis
7	9598.ENSPTRP00000001359	0.970	Protein kinase, AMP-activated, alpha 2 catalytic subunit
8	9598.ENSPTRP00000023022	0.963	Uncharacterized protein
9	9598.ENSPTRP00000022860	0.946	acyl-CoA synthetase short-chain family member 1
10	9598.ENSPTRP00000009369	0.943	Pan troglodytes protein kinase, AMP-activated, beta 1 non-catalytic subunit (PRKAB1), mRNA
11	9598.ENSPTRP00000014443	0.943	acyl-CoA synthetase family member 3
12	9598.ENSPTRP00000008366	0.942	Protein kinase, AMP-activated, gamma 1 non-catalytic subunit
13	9598.ENSPTRP00000007309	0.941	Acetyl-CoA acetyltransferase 1
14	9598.ENSPTRP00000047541	0.941	Protein kinase, AMP-activated, gamma 2 non-catalytic subunit
15	9598.ENSPTRP00000055489	0.941	Uncharacterized protein
16	9598.ENSPTRP00000002072	0.937	Protein kinase, AMP-activated, beta 2 non-catalytic subunit
17	9598.ENSPTRP00000023914	0.920	Uncharacterized protein
18	9598.ENSPTRP00000045223	0.918	Trifunctional purine biosynthetic protein adenosine-3
19	9598.ENSPTRP00000007349	0.915	Acetyltransferase component of pyruvate dehydrogenase complex
20	9598.ENSPTRP00000022095	0.914	Protein kinase, AMP-activated, gamma 3 non-catalytic subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003989	0.998	acetyl-CoA carboxylase activity
GO:1901681	0.982	sulfur compound binding
GO:0033218	0.981	amide binding
GO:0043168	0.977	anion binding
GO:0036094	0.967	small molecule binding
GO:1901363	0.957	heterocyclic compound binding
GO:0097159	0.957	organic cyclic compound binding
GO:0042802	0.818	identical protein binding
GO:0033293	0.730	monocarboxylic acid binding
GO:0019842	0.661	vitamin binding
GO:0009374	0.363	biotin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.985	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044281	0.982	small molecule metabolic process
GO:0044237	0.979	cellular metabolic process
GO:0019752	0.958	carboxylic acid metabolic process
GO:0009058	0.957	biosynthetic process
GO:0006629	0.956	lipid metabolic process
GO:0044249	0.947	cellular biosynthetic process
GO:0050896	0.945	response to stimulus
GO:0006807	0.939	nitrogen compound metabolic process
GO:1901576	0.939	organic substance biosynthetic process
GO:0044283	0.935	small molecule biosynthetic process
GO:0032787	0.935	monocarboxylic acid metabolic process
GO:1901564	0.920	organonitrogen compound metabolic process
GO:0044255	0.913	cellular lipid metabolic process
GO:0072330	0.912	monocarboxylic acid biosynthetic process
GO:0006633	0.904	fatty acid biosynthetic process
GO:0006637	0.887	acyl-CoA metabolic process
GO:0009260	0.673	ribonucleotide biosynthetic process
GO:0072522	0.656	purine-containing compound biosynthetic process
GO:0010033	0.624	response to organic substance
GO:0006164	0.617	purine nucleotide biosynthetic process
GO:0034030	0.589	ribonucleoside bisphosphate biosynthetic process
GO:0009152	0.583	purine ribonucleotide biosynthetic process
GO:0044272	0.569	sulfur compound biosynthetic process
GO:0043604	0.554	amide biosynthetic process
GO:0071616	0.490	acyl-CoA biosynthetic process
GO:0065007	0.459	biological regulation
GO:0050789	0.432	regulation of biological process
GO:0050794	0.372	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005829	0.978	cytosol
GO:0005739	0.940	mitochondrion
GO:0005634	0.768	nucleus
GO:0070013	0.357	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11308	0.998	acetyl-CoA + ATP + hydrogencarbonate = ADP + H(+) + malonyl-CoA + phosphate
EC:6.4.1.2	0.998	acetyl-CoA carboxylase.

[back to server]