StarFunc result for job id Q13093

User Input

>input (441 residues)
MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGN
GPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNI
LRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHR
DRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
HGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAWMF
PLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSVHQNFADFTFA
TGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT
NINTTNQHIMLQNSSGIEKYN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13093	1.000	1.000	6.568E-92	441	1.000	1.000	Q13093.pdb.gz	PAFA_HUMAN Platelet-activating factor acetylhydrolase OS=Homo sapiens OX=9606 GN=PLA2G7 PE=1 SV=1
2	PDB:3f98A	0.842	0.984	1.005E-73	377	0.855	1.000	3f98A.pdb.gz	Crystal structures of human group-VIIA phospholipase A2 inhibited by organophosphorus nerve agents exhibit non-aged complexes.
3	AFDB:Q5M7T7	0.895	0.897	6.362E-68	440	0.683	0.684	Q5M7T7.pdb.gz
4	AFDB:Q60963	0.855	0.857	8.555E-65	440	0.676	0.677	Q60963.pdb.gz	PAFA_MOUSE Platelet-activating factor acetylhydrolase OS=Mus musculus OX=10090 GN=Pla2g7 PE=1 SV=2
5	AFDB:Q99487	0.798	0.895	2.331E-44	392	0.365	0.411	Q99487.pdb.gz	PAFA2_HUMAN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=PAFAH2 PE=1 SV=1
6	AFDB:P83006	0.798	0.900	4.630E-44	390	0.365	0.413	P83006.pdb.gz	PAFA2_RAT Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Pafah2 PE=1 SV=2
7	AFDB:P79106	0.791	0.887	1.538E-43	392	0.347	0.390	P79106.pdb.gz	PAFA2_BOVIN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Bos taurus OX=9913 GN=PAFAH2 PE=1 SV=1
8	AFDB:G5EGT1	0.759	0.866	4.510E-35	384	0.274	0.315	G5EGT1.pdb.gz	G5EGT1_CAEEL 1-alkyl-2-acetylglycerophosphocholine esterase OS=Caenorhabditis elegans OX=6239 GN=paf-1 PE=2 SV=1
9	AFDB:Q22943	0.766	0.867	7.125E-35	388	0.272	0.309	Q22943.pdb.gz	PAFA_CAEEL Platelet-activating factor acetylhydrolase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=paf-2 PE=2 SV=2
10	AFDB:Q9URV1	0.696	0.701	1.204E-20	438	0.231	0.233	Q9URV1.pdb.gz	PLG7_SCHPO Putative phospholipase A2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plg7 PE=3 SV=1
11	AFDB:Q38DE4	0.596	0.589	2.155E-17	447	0.172	0.170	Q38DE4.pdb.gz	Q38DE4_TRYB2 1-alkyl-2-acetylglycerophosphocholine esterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3650 PE=4 SV=1
12	PDB:4cg3A	0.444	0.718	9.522E-12	263	0.127	0.213	4cg3A.pdb.gz
13	PDB:7qvhB	0.467	0.728	6.652E-11	272	0.098	0.158	7qvhB.pdb.gz
14	PDB:5xg0C	0.462	0.730	9.374E-11	268	0.095	0.157	5xg0C.pdb.gz
15	PDB:6y0fC	0.327	0.214	9.324E-7	722	0.098	0.060	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
16	PDB:5l2pA	0.329	0.445	3.473E-6	306	0.104	0.150	5l2pA.pdb.gz
17	PDB:3m83A	0.362	0.478	4.622E-6	325	0.088	0.120	3m83A.pdb.gz	Functional and structural characterization of a thermostable acetyl esterase from Thermotoga maritima.
18	PDB:4n8eB	0.348	0.222	5.810E-6	734	0.095	0.057	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
19	PDB:6ehnA	0.265	0.290	6.152E-6	397	0.100	0.111	6ehnA.pdb.gz
20	PDB:6rs4A	0.334	0.447	8.669E-6	315	0.093	0.130	6rs4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y241	0.0	606	418	0.644	0.679	A0A8I5Y241_RAT Platelet-activating factor acetylhydrolase OS=Rattus norvegicus OX=10116 GN=Pla2g7 PE=4 SV=1
2	A0A8I6GE94	0.0	606	410	0.644	0.693	A0A8I6GE94_RAT Platelet-activating factor acetylhydrolase OS=Rattus norvegicus OX=10116 GN=Pla2g7 PE=4 SV=1
3	Q13093	0.0	925	441	1.000	1.000	PAFA_HUMAN Platelet-activating factor acetylhydrolase OS=Homo sapiens OX=9606 GN=PLA2G7 PE=1 SV=1
4	Q60963	0.0	621	440	0.673	0.675	PAFA_MOUSE Platelet-activating factor acetylhydrolase OS=Mus musculus OX=10090 GN=Pla2g7 PE=1 SV=2
5	P83006	7.18e-107	323	390	0.372	0.421	PAFA2_RAT Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Pafah2 PE=1 SV=2
6	Q99487	9.63e-104	315	392	0.370	0.416	PAFA2_HUMAN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Homo sapiens OX=9606 GN=PAFAH2 PE=1 SV=1
7	P79106	3.83e-96	296	392	0.356	0.401	PAFA2_BOVIN Platelet-activating factor acetylhydrolase 2, cytoplasmic OS=Bos taurus OX=9913 GN=PAFAH2 PE=1 SV=1
8	Q22943	9.10e-59	199	388	0.268	0.304	PAFA_CAEEL Platelet-activating factor acetylhydrolase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=paf-2 PE=2 SV=2
9	G5EGT1	9.64e-57	194	384	0.261	0.299	G5EGT1_CAEEL 1-alkyl-2-acetylglycerophosphocholine esterase OS=Caenorhabditis elegans OX=6239 GN=paf-1 PE=2 SV=1
10	Q9URV1	2.26e-21	98.2	438	0.252	0.253	PLG7_SCHPO Putative phospholipase A2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plg7 PE=3 SV=1
11	E9AFC6	9.20e-15	78.2	453	0.202	0.196	E9AFC6_LEIMA 1-alkyl-2-acetylglycerophosphocholine esterase OS=Leishmania major OX=5664 GN=LMJF_35_3020 PE=4 SV=1
12	Q38DE4	1.00e-12	72.0	447	0.129	0.128	Q38DE4_TRYB2 1-alkyl-2-acetylglycerophosphocholine esterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3650 PE=4 SV=1
13	F7IX06	0.001	42.7	300	0.095	0.140	PETH2_THEAE Cutinase est2 OS=Thermobifida alba OX=53522 GN=est2 PE=1 SV=1
14	Q47RJ6	0.30	35.4	301	0.036	0.053	PETH2_THEFY Cutinase OS=Thermobifida fusca (strain YX) OX=269800 GN=TfH PE=1 SV=1
15	Q6A0I4	0.30	35.4	301	0.036	0.053	PETH2_THEFU Cutinase cut2 OS=Thermobifida fusca OX=2021 GN=cut2 PE=1 SV=1
16	Q9A405	0.40	35.4	335	0.050	0.066	Q9A405_CAUVC Dienelactone hydrolase OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=CC_3039 PE=4 SV=1
17	G8GER6	0.47	35.0	319	0.082	0.113	PETH1_THEFU Cutinase cut1 OS=Thermobifida fusca OX=2021 GN=cut_1 PE=1 SV=1
18	Q47RJ7	0.47	35.0	319	0.082	0.113	PETH1_THEFY Cutinase OS=Thermobifida fusca (strain YX) OX=269800 GN=Tfu_0882 PE=1 SV=1
19	Q9M7I7	0.86	34.3	318	0.052	0.072	CLH2_ARATH Chlorophyllase-2 OS=Arabidopsis thaliana OX=3702 GN=CLH2 PE=1 SV=1
20	P74506	0.89	34.3	538	0.082	0.067	P74506_SYNY3 Slr1944 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1944 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	0.0052	28.0	alpha/beta hydrolase fold
2	PF02230 Abhydrolase_2	15	16.9	Phospholipase/Carboxylesterase
3	PF07859 Abhydrolase_3	4.8e+02	12.0	alpha/beta hydrolase fold
4	PF12695 Abhydrolase_5	39	15.5	Alpha/beta hydrolase family
5	PF12697 Abhydrolase_6	2.8	20.0	Alpha/beta hydrolase family
6	PF07224 Chlorophyllase	0.11	23.1	Chlorophyllase
7	PF12740 Chlorophyllase2	1.4e-05	35.8	Chlorophyllase enzyme
8	PF01738 DLH	1e+02	13.9	Dienelactone hydrolase family
9	PF05057 DUF676	4.9e+02	11.6	Putative serine esterase (DUF676)
10	PF12146 Hydrolase_4	0.00067	30.5	Serine aminopeptidase, S33
11	PF01764 Lipase_3	5.4e+02	11.9	Lipase (class 3)
12	PF03403 PAF-AH_p_II	2e-179	607.6	Platelet-activating factor acetylhydrolase, isoform II
13	PF00326 Peptidase_S9	0.046	24.8	Prolyl oligopeptidase family
14	PF07819 PGAP1	3.2e+02	12.4	PGAP1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274793

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312286	0.968	Phospholipase A2
2	9606.ENSP00000233242	0.967	Apolipoprotein B-100
3	9606.ENSP00000262134	0.958	Lysophosphatidylcholine acyltransferase 2
4	9606.ENSP00000252486	0.949	Apolipoprotein E
5	9606.ENSP00000445002	0.920	Apolipoprotein A-V
6	9606.ENSP00000380378	0.916	Platelet-activating factor acetylhydrolase IB subunit alpha
7	9606.ENSP00000283415	0.912	Lysophosphatidylcholine acyltransferase 1
8	9606.ENSP00000236850	0.909	Apolipoprotein A-I
9	9606.ENSP00000393847	0.905	Group 10 secretory phospholipase A2
10	9606.ENSP00000335074	0.904	Appetite-regulating hormone
11	9606.ENSP00000356563	0.900	Peroxisomal biogenesis factor 3
12	9606.ENSP00000439012	0.900	Acyl-CoA-binding protein
13	9606.ENSP00000356436	0.894	Cytosolic phospholipase A2
14	9606.ENSP00000383364	0.893	Phospholipase A2, membrane associated
15	9606.ENSP00000222381	0.871	Serum paraoxonase/arylesterase 1
16	9606.ENSP00000200676	0.870	Cholesteryl ester transfer protein
17	9606.ENSP00000382434	0.869	Cytosolic phospholipase A2 epsilon
18	9606.ENSP00000435289	0.866	Platelet-activating factor acetylhydrolase IB subunit beta
19	9606.ENSP00000227667	0.855	Apolipoprotein C-III
20	9606.ENSP00000444935	0.853	Platelet-activating factor acetylhydrolase IB subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005543	1.000	phospholipid binding
GO:0003847	1.000	1-alkyl-2-acetylglycerophosphocholine esterase activity
GO:0047499	0.998	calcium-independent phospholipase A2 activity
GO:0005515	0.383	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006629	0.982	lipid metabolic process
GO:0009987	0.980	cellular process
GO:0044237	0.972	cellular metabolic process
GO:0065007	0.968	biological regulation
GO:0009056	0.946	catabolic process
GO:0044255	0.946	cellular lipid metabolic process
GO:1901575	0.927	organic substance catabolic process
GO:0006650	0.926	glycerophospholipid metabolic process
GO:0050789	0.920	regulation of biological process
GO:0044248	0.878	cellular catabolic process
GO:0016042	0.834	lipid catabolic process
GO:0050794	0.794	regulation of cellular process
GO:1901564	0.735	organonitrogen compound metabolic process
GO:0046470	0.709	phosphatidylcholine metabolic process
GO:0044242	0.666	cellular lipid catabolic process
GO:0050896	0.563	response to stimulus
GO:0046503	0.554	glycerolipid catabolic process
GO:0032501	0.523	multicellular organismal process
GO:0048518	0.509	positive regulation of biological process
GO:0048583	0.477	regulation of response to stimulus
GO:0046434	0.477	organophosphate catabolic process
GO:0071840	0.458	cellular component organization or biogenesis
GO:0046475	0.458	glycerophospholipid catabolic process
GO:0048522	0.452	positive regulation of cellular process
GO:0016043	0.446	cellular component organization
GO:0006950	0.359	response to stress
GO:1901565	0.304	organonitrogen compound catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0032991	0.983	protein-containing complex
GO:0032994	0.967	protein-lipid complex
GO:0005622	0.956	intracellular anatomical structure
GO:0043226	0.953	organelle
GO:0034358	0.953	plasma lipoprotein particle
GO:0005737	0.944	cytoplasm
GO:0043227	0.941	membrane-bounded organelle
GO:0043231	0.929	intracellular membrane-bounded organelle
GO:0034364	0.909	high-density lipoprotein particle
GO:0016020	0.864	membrane
GO:0012505	0.713	endomembrane system
GO:0005783	0.405	endoplasmic reticulum
GO:0031974	0.376	membrane-enclosed lumen
GO:0070013	0.357	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17777	1.000	a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+)
EC:3.1.1.47	1.000	1-alkyl-2-acetylglycerophosphocholine esterase.
RHEA:15801	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	1.000	phospholipase A2.

[back to server]