StarFunc result for job id Q13094

User Input

>input (533 residues)
MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKL
RVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ
DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSG
KTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK
PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPL
PGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHM
PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES
QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13094	0.999	0.999	5.283E-81	533	1.000	1.000	Q13094.pdb.gz	LCP2_HUMAN Lymphocyte cytosolic protein 2 OS=Homo sapiens OX=9606 GN=LCP2 PE=1 SV=1
2	AFDB:Q60787	0.392	0.392	4.038E-66	533	0.837	0.837	Q60787.pdb.gz	LCP2_MOUSE Lymphocyte cytosolic protein 2 OS=Mus musculus OX=10090 GN=Lcp2 PE=1 SV=2
3	AFDB:Q9DG07	0.218	0.219	2.414E-48	530	0.576	0.579	Q9DG07.pdb.gz	Q9DG07_CHICK SLP-76 adaptor protein OS=Gallus gallus OX=9031 GN=SLP76 PE=1 SV=1
4	PDB:1ka6A	0.170	0.773	3.897E-7	107	0.047	0.234	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
5	AFDB:A0A5F9YLF9	0.200	0.167	6.316E-7	645	0.180	0.149	A0A5F9YLF9.pdb.gz	A0A5F9YLF9_HUMAN Suppressor of cytokine signaling 7 OS=Homo sapiens OX=9606 GN=SOCS7 PE=1 SV=1
6	PDB:4gwfA	0.169	0.180	1.219E-6	497	0.053	0.056	4gwfA.pdb.gz
7	PDB:3ps5A	0.164	0.165	4.299E-6	529	0.049	0.049	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
8	PDB:1griA	0.165	0.401	1.123E-5	211	0.053	0.133	1griA.pdb.gz
9	PDB:4fl2A	0.167	0.161	1.610E-5	555	0.049	0.047	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
10	PDB:8dcxB	0.169	0.365	2.763E-5	236	0.060	0.136	8dcxB.pdb.gz
11	PDB:5xzrA	0.158	0.162	3.115E-5	519	0.056	0.058	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	PDB:4k2rA	0.164	0.158	6.798E-5	551	0.053	0.051	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	AFDB:Q04205	0.164	0.054	6.816E-5	1744	0.195	0.060	Q04205.pdb.gz	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
14	AFDB:Q63HR2	0.146	0.057	1.170E-4	1409	0.174	0.066	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
15	AFDB:Q9HBL0	0.153	0.050	2.552E-4	1735	0.159	0.049	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
16	PDB:3cxlA	0.111	0.145	2.703E-4	402	0.036	0.047	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
17	AFDB:O74653	0.111	0.070	2.710E-4	871	0.148	0.091	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
18	AFDB:E9Q0S6	0.149	0.044	3.245E-4	1888	0.161	0.046	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
19	PDB:2lqnA	0.139	0.237	4.114E-4	303	0.043	0.076	2lqnA.pdb.gz
20	AFDB:A0A1D8PRW9	0.131	0.068	1.078E-3	1172	0.133	0.061	A0A1D8PRW9.pdb.gz	A0A1D8PRW9_CANAL Boi2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BOI2 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13094	0.0	1073	533	1.000	1.000	LCP2_HUMAN Lymphocyte cytosolic protein 2 OS=Homo sapiens OX=9606 GN=LCP2 PE=1 SV=1
2	Q60787	0.0	847	533	0.827	0.827	LCP2_MOUSE Lymphocyte cytosolic protein 2 OS=Mus musculus OX=10090 GN=Lcp2 PE=1 SV=2
3	Q9DG07	4.57e-174	503	530	0.583	0.587	Q9DG07_CHICK SLP-76 adaptor protein OS=Gallus gallus OX=9031 GN=SLP76 PE=1 SV=1
4	Q9QZE2	3.52e-34	136	435	0.191	0.234	CLNK_MOUSE Cytokine-dependent hematopoietic cell linker OS=Mus musculus OX=10090 GN=Clnk PE=1 SV=1
5	Q7Z7G1	8.31e-30	123	428	0.111	0.138	CLNK_HUMAN Cytokine-dependent hematopoietic cell linker OS=Homo sapiens OX=9606 GN=CLNK PE=1 SV=2
6	Q9QUN3	8.25e-24	106	457	0.268	0.313	BLNK_MOUSE B-cell linker protein OS=Mus musculus OX=10090 GN=Blnk PE=1 SV=1
7	Q8WV28	1.09e-21	100	456	0.251	0.294	BLNK_HUMAN B-cell linker protein OS=Homo sapiens OX=9606 GN=BLNK PE=1 SV=2
8	Q9YGC1	6.04e-18	89.4	552	0.075	0.072	BLNK_CHICK B-cell linker protein OS=Gallus gallus OX=9031 GN=BLNK PE=1 SV=1
9	O54737	1.22e-09	63.2	516	0.066	0.068	O54737_MOUSE BCA protein (Fragment) OS=Mus musculus OX=10090 GN=Blnk PE=1 SV=1
10	Q804J6	1.20e-07	57.4	1312	0.084	0.034	Q804J6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Danio rerio OX=7955 GN=fj46f04 PE=1 SV=1
11	Q62077	4.39e-07	55.5	1302	0.086	0.035	PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus OX=10090 GN=Plcg1 PE=1 SV=2
12	P19174	4.50e-07	55.5	1290	0.116	0.048	PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1
13	P08487	4.74e-07	55.5	1291	0.086	0.036	PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus OX=9913 GN=PLCG1 PE=1 SV=1
14	P10686	5.12e-07	55.1	1290	0.086	0.036	PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus OX=10116 GN=Plcg1 PE=1 SV=1
15	F1SDV6	7.80e-07	54.7	1291	0.084	0.035	F1SDV6_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Sus scrofa OX=9823 GN=PLCG1 PE=1 SV=5
16	P29349	4.59e-06	52.0	845	0.058	0.037	CSW_DROME Tyrosine-protein phosphatase corkscrew OS=Drosophila melanogaster OX=7227 GN=csw PE=1 SV=2
17	Q1JPZ3	8.81e-06	50.8	534	0.054	0.054	SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio OX=7955 GN=src PE=1 SV=2
18	Q9UN19	2.35e-05	48.5	280	0.066	0.125	DAPP1_HUMAN Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide OS=Homo sapiens OX=9606 GN=DAPP1 PE=1 SV=1
19	W5UIG7	3.73e-05	49.3	1118	0.056	0.027	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
20	A0A0C5AMM3	4.27e-05	48.9	1116	0.056	0.027	A0A0C5AMM3_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	2.1e+02	13.8	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	1.3e-05	36.5	SAM domain (Sterile alpha motif)
3	PF00017 SH2	6.3e-11	53.6	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000046794

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000264972	0.999	Tyrosine-protein kinase ZAP-70
3	9606.ENSP00000339186	0.999	GRB2-related adapter protein 2
4	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
5	9606.ENSP00000378845	0.999	Linker for activation of T cells
6	9606.ENSP00000398655	0.999	Tyrosine-protein kinase ITK/TSK
7	9606.ENSP00000417273	0.999	Cytoplasmic protein NCK1
8	9606.ENSP00000427114	0.999	FYN-binding protein 1
9	9606.ENSP00000472929	0.999	Proto-oncogene vav
10	9606.ENSP00000337825	0.998	Tyrosine-protein kinase Lck
11	9606.ENSP00000365891	0.998	Wiskott-Aldrich syndrome protein
12	9606.ENSP00000465039	0.997	Mitogen-activated protein kinase kinase kinase kinase 1
13	9606.ENSP00000364907	0.996	Tyrosine-protein kinase SYK
14	9606.ENSP00000244007	0.993	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
15	9606.ENSP00000011653	0.988	T-cell surface glycoprotein CD4
16	9606.ENSP00000483570	0.987	Tyrosine-protein kinase BTK
17	9606.ENSP00000482457	0.984	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
18	9606.ENSP00000323280	0.981	T-cell differentiation antigen CD6
19	9606.ENSP00000359073	0.981	Guanine nucleotide exchange factor VAV3
20	9606.ENSP00000391592	0.977	Tyrosine-protein phosphatase non-receptor type 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.380	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0007165	0.988	signal transduction
GO:0002376	0.983	immune system process
GO:0048583	0.980	regulation of response to stimulus
GO:0002682	0.969	regulation of immune system process
GO:0007166	0.957	cell surface receptor signaling pathway
GO:0050776	0.954	regulation of immune response
GO:0048522	0.950	positive regulation of cellular process
GO:0002684	0.933	positive regulation of immune system process
GO:0065009	0.923	regulation of molecular function
GO:0048584	0.915	positive regulation of response to stimulus
GO:0050778	0.909	positive regulation of immune response
GO:0009893	0.890	positive regulation of metabolic process
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0031323	0.886	regulation of cellular metabolic process
GO:0080090	0.881	regulation of primary metabolic process
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0002764	0.823	immune response-regulating signaling pathway
GO:0051171	0.803	regulation of nitrogen compound metabolic process
GO:0002768	0.798	immune response-regulating cell surface receptor signaling pathway
GO:0031325	0.768	positive regulation of cellular metabolic process
GO:0006955	0.712	immune response
GO:0002253	0.674	activation of immune response
GO:0002757	0.659	immune response-activating signaling pathway
GO:0051173	0.618	positive regulation of nitrogen compound metabolic process
GO:0050790	0.588	regulation of catalytic activity
GO:0002429	0.569	immune response-activating cell surface receptor signaling pathway
GO:0019220	0.551	regulation of phosphate metabolic process
GO:0032501	0.547	multicellular organismal process
GO:0051246	0.545	regulation of protein metabolic process
GO:0042325	0.498	regulation of phosphorylation
GO:0031399	0.477	regulation of protein modification process
GO:0044093	0.443	positive regulation of molecular function
GO:0050851	0.412	antigen receptor-mediated signaling pathway
GO:0001932	0.391	regulation of protein phosphorylation
GO:0042327	0.378	positive regulation of phosphorylation
GO:0043549	0.367	regulation of kinase activity
GO:0051247	0.338	positive regulation of protein metabolic process
GO:0001775	0.301	cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.985	membrane
GO:0005886	0.980	plasma membrane
GO:0032991	0.891	protein-containing complex
GO:0043226	0.809	organelle
GO:0043231	0.785	intracellular membrane-bounded organelle
GO:0045121	0.672	membrane raft
GO:0098590	0.493	plasma membrane region
GO:0030054	0.396	cell junction
GO:0036398	0.366	TCR signalosome
GO:0043233	0.303	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]