StarFunc result for job id Q13099

User Input

>input (824 residues)
MMQNVHLAPETDEDDLYSGYNDYNPIYDIEELENDAAFQQAVRTSHGRRPPITAKISSTA
VTRPIATGYGSKTSLASSIGRPMTGAIQDGVTRPMTAVRAAGFTKAALRGSAFDPLSQSR
GPASPLEAKKKDSPEEKIKQLEKEVNELVEESCIANSCGDLKLALEKAKDAGRKERVLVR
QREQVTTPENINLDLTYSVLFNLASQYSVNEMYAEALNTYQVIVKNKMFSNAGILKMNMG
NIYLKQRNYSKAIKFYRMALDQVPSVNKQMRIKIMQNIGVTFIQAGQYSDAINSYEHIMS
MAPNLKAGYNLTICYFAIGDREKMKKAFQKLITVPLEIDEDKYISPSDDPHTNLVTEAIK
NDHLRQMERERKAMAEKYIMTSAKLIAPVIETSFAAGYDWCVEVVKASQYVELANDLEIN
KAVTYLRQKDYNQAVEILKVLEKKDSRVKSAAATNLSALYYMGKDFAQASSYADIAVNSD
RYNPAALTNKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYEKLNRLDEALDC
FLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDREG
DKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMV
ASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMK
EIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSS
NKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13099	1.000	1.000	3.645E-89	824	1.000	1.000	Q13099.pdb.gz	IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88 PE=1 SV=3
2	AFDB:Q61371	0.828	0.828	2.570E-80	824	0.891	0.891	Q61371.pdb.gz	IFT88_MOUSE Intraflagellar transport protein 88 homolog OS=Mus musculus OX=10090 GN=Ift88 PE=1 SV=2
3	AFDB:A0A2R8QRB2	0.425	0.440	3.227E-63	795	0.717	0.743	A0A2R8QRB2.pdb.gz
4	AFDB:Q386Y0	0.642	0.660	2.851E-41	800	0.387	0.399	Q386Y0.pdb.gz	Q386Y0_TRYB2 Intraflagellar transport protein IFT88, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0006 PE=4 SV=1
5	AFDB:Q7KJA9	0.292	0.239	1.089E-15	1059	0.126	0.098	Q7KJA9.pdb.gz	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
6	AFDB:Q9M8Y0	0.338	0.290	1.318E-15	977	0.129	0.108	Q9M8Y0.pdb.gz	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
7	AFDB:Q57WP4	0.308	0.364	6.081E-15	673	0.117	0.143	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
8	AFDB:O18158	0.331	0.245	2.700E-14	1151	0.126	0.090	O18158.pdb.gz	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
9	AFDB:P09798	0.239	0.236	1.111E-13	840	0.136	0.133	P09798.pdb.gz	CDC16_YEAST Anaphase-promoting complex subunit CDC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC16 PE=1 SV=1
10	AFDB:Q62018	0.252	0.193	1.452E-13	1173	0.159	0.112	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
11	PDB:8a3tJ	0.231	0.342	6.658E-12	509	0.092	0.149	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
12	PDB:5dseA	0.259	0.356	1.181E-11	537	0.106	0.162	5dseA.pdb.gz
13	PDB:7qe7J	0.248	0.369	4.333E-11	510	0.090	0.145	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:6bq1B	0.256	0.281	4.860E-11	728	0.114	0.129	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
15	PDB:7qe7Y	0.221	0.333	5.049E-11	502	0.095	0.155	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:7ntfA	0.281	0.259	5.450E-11	918	0.109	0.098	7ntfA.pdb.gz
17	PDB:7dkhI	0.208	0.192	7.400E-11	914	0.126	0.114	7dkhI.pdb.gz
18	PDB:6tedQ	0.234	0.222	1.216E-10	890	0.131	0.121	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:8a3tH	0.236	0.358	2.514E-10	505	0.090	0.147	8a3tH.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:4bujB	0.236	0.157	2.820E-10	1367	0.106	0.064	4bujB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ACI9	0.0	1457	788	0.851	0.890	D4ACI9_RAT Intraflagellar transport 88 OS=Rattus norvegicus OX=10116 GN=Ift88 PE=4 SV=2
2	G5ED37	0.0	677	820	0.445	0.448	G5ED37_CAEEL Intraflagellar transport protein 88 homolog OS=Caenorhabditis elegans OX=6239 GN=osm-5 PE=2 SV=1
3	Q13099	0.0	1708	824	1.000	1.000	IFT88_HUMAN Intraflagellar transport protein 88 homolog OS=Homo sapiens OX=9606 GN=IFT88 PE=1 SV=3
4	Q386Y0	0.0	587	800	0.359	0.370	Q386Y0_TRYB2 Intraflagellar transport protein IFT88, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.55.0006 PE=4 SV=1
5	Q61371	0.0	1541	824	0.893	0.893	IFT88_MOUSE Intraflagellar transport protein 88 homolog OS=Mus musculus OX=10090 GN=Ift88 PE=1 SV=2
6	Q6RUQ9	0.0	1327	824	0.749	0.749	Q6RUQ9_DANRE Ift88 OS=Danio rerio OX=7955 GN=fb37b11 PE=1 SV=1
7	Q9FPW0	0.0	541	782	0.363	0.382	Q9FPW0_CHLRE Intraflagellar transport particle protein IFT88 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT88 PE=2 SV=1
8	Q9V9R6	4.47e-118	379	840	0.353	0.346	Q9V9R6_DROME No mechanoreceptor potential B, isoform C OS=Drosophila melanogaster OX=7227 GN=nompB PE=4 SV=4
9	Q7KRS6	4.69e-114	369	857	0.351	0.337	Q7KRS6_DROME No mechanoreceptor potential B, isoform D OS=Drosophila melanogaster OX=7227 GN=nompB PE=4 SV=2
10	Q5GA11	2.97e-12	73.2	1046	0.138	0.109	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
11	P56558	2.99e-12	73.2	1036	0.141	0.112	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
12	Q5GA12	3.06e-12	73.2	1052	0.138	0.108	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
13	Q5GA10	3.34e-12	72.8	1036	0.138	0.110	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
14	Q5GA13	3.93e-12	72.8	1062	0.140	0.108	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
15	Q8CGY8	4.15e-12	72.4	1046	0.141	0.111	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
16	P81436	5.27e-12	72.4	1046	0.138	0.109	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
17	O15294	5.69e-12	72.0	1046	0.138	0.109	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
18	Q9Y148	9.21e-12	71.2	1011	0.136	0.111	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
19	Q7KJA9	9.78e-12	71.2	1059	0.125	0.097	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
20	O51213	1.72e-11	69.3	379	0.066	0.142	O51213_BORBU TPR domain protein OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0195 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14863 Alkyl_sulf_dimr	37	16.1	Alkyl sulfatase dimerisation
2	PF12895 ANAPC3	7.5e-12	56.7	Anaphase-promoting complex, cyclosome, subunit 3
3	PF03704 BTAD	3e+02	13.2	Bacterial transcriptional activator domain
4	PF04733 Coatomer_E	17	16.3	Coatomer epsilon subunit
5	PF09986 DUF2225	1.6e+02	13.4	Uncharacterized protein conserved in bacteria (DUF2225)
6	PF16068 DUF4810	3.2e+02	13.3	Domain of unknown function (DUF4810)
7	PF20225 DUF6584	9.7	17.6	Family of unknown function (DUF6584)
8	PF13934 ELYS	2.8e+02	12.8	Nuclear pore complex assembly
9	PF11817 Foie-gras_1	1.9e+02	13.1	Foie gras liver health family 1
10	PF10415 FumaraseC_C	3.1e+02	13.1	Fumarase C C-terminus
11	PF09613 HrpB1_HrpK	1.8e+02	13.2	Bacterial type III secretion protein (HrpB1_HrpK)
12	PF10300 Iml2-TPR_39	0.067	23.5	Iml2/Tetratricopeptide repeat protein 39
13	PF04212 MIT	1.9e+02	13.5	MIT (microtubule interacting and transport) domain
14	PF01535 PPR	14	17.3	PPR repeat
15	PF10602 RPN7	6.1	18.0	26S proteasome subunit RPN7
16	PF18058 SbsC_C	4.7e+02	12.4	SbsC C-terminal domain
17	PF08238 Sel1	17	17.5	Sel1 repeat
18	PF20308 TPR-S	1.4e-05	36.9	Tetratricopeptide Repeats-Sensor
19	PF00515 TPR_1	1.5e-40	146.6	Tetratricopeptide repeat
20	PF13374 TPR_10	9.8e-07	39.7	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323580

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264538	0.999	Intraflagellar transport protein 57 homolog
2	9606.ENSP00000362121	0.999	Intraflagellar transport protein 52 homolog
3	9606.ENSP00000242591	0.998	Intraflagellar transport protein 81 homolog
4	9606.ENSP00000312778	0.997	Intraflagellar transport protein 80 homolog
5	9606.ENSP00000464443	0.996	Intraflagellar transport protein 20 homolog
6	9606.ENSP00000260570	0.995	Intraflagellar transport protein 172 homolog
7	9606.ENSP00000367766	0.995	X-linked retinitis pigmentosa GTPase regulator
8	9606.ENSP00000404122	0.994	Intraflagellar transport protein 74 homolog
9	9606.ENSP00000264020	0.990	Intraflagellar transport proteins
10	9606.ENSP00000419279	0.989	Intraflagellar transport protein 56
11	9606.ENSP00000386181	0.986	Tetratricopeptide repeat protein 30B
12	9606.ENSP00000385808	0.985	Kinesin-like protein KIF3A
13	9606.ENSP00000406012	0.984	Intraflagellar transport protein 140 homolog
14	9606.ENSP00000362424	0.982	TRAF3-interacting protein 1
15	9606.ENSP00000460850	0.981	Clusterin-associated protein 1
16	9606.ENSP00000296266	0.973	Intraflagellar transport protein 122 homolog
17	9606.ENSP00000320359	0.973	Intraflagellar transport protein 22 homolog
18	9606.ENSP00000347915	0.973	Tetratricopeptide repeat protein 30A
19	9606.ENSP00000393541	0.973	Intraflagellar transport protein 27 homolog
20	9606.ENSP00000382717	0.969	WD repeat-containing protein 19

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.610	cytoskeletal protein binding
GO:0019894	0.432	kinesin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0043583	0.989	ear development
GO:0060972	0.989	left/right pattern formation
GO:0007017	0.987	microtubule-based process
GO:1905515	0.987	non-motile cilium assembly
GO:0030154	0.982	cell differentiation
GO:0048731	0.980	system development
GO:0048522	0.979	positive regulation of cellular process
GO:0031503	0.964	protein-containing complex localization
GO:0060113	0.953	inner ear receptor cell differentiation
GO:0009855	0.951	determination of bilateral symmetry
GO:0051234	0.948	establishment of localization
GO:0051716	0.944	cellular response to stimulus
GO:0001894	0.942	tissue homeostasis
GO:0023051	0.940	regulation of signaling
GO:0007368	0.937	determination of left/right symmetry
GO:0051649	0.935	establishment of localization in cell
GO:0006810	0.933	transport
GO:0060119	0.926	inner ear receptor cell development
GO:0000278	0.918	mitotic cell cycle
GO:0010646	0.916	regulation of cell communication
GO:0007369	0.915	gastrulation
GO:0007154	0.913	cell communication
GO:0009966	0.912	regulation of signal transduction
GO:0023052	0.911	signaling
GO:0022402	0.896	cell cycle process
GO:0060122	0.894	inner ear receptor cell stereocilium organization
GO:0009888	0.888	tissue development
GO:0099111	0.888	microtubule-based transport
GO:0001822	0.888	kidney development
GO:0010970	0.881	transport along microtubule
GO:0007165	0.875	signal transduction
GO:0042073	0.861	intraciliary transport
GO:0048872	0.860	homeostasis of number of cells
GO:1902115	0.859	regulation of organelle assembly
GO:0035295	0.856	tube development
GO:1903047	0.845	mitotic cell cycle process
GO:0000226	0.842	microtubule cytoskeleton organization
GO:0009967	0.842	positive regulation of signal transduction
GO:0060429	0.833	epithelium development
GO:0048873	0.823	homeostasis of number of cells within a tissue
GO:0072009	0.803	nephron epithelium development
GO:0003341	0.802	cilium movement
GO:0007166	0.789	cell surface receptor signaling pathway
GO:0061326	0.772	renal tubule development
GO:0010941	0.744	regulation of cell death
GO:0030010	0.697	establishment of cell polarity
GO:0060491	0.685	regulation of cell projection assembly
GO:0050877	0.670	nervous system process
GO:0120032	0.654	regulation of plasma membrane bounded cell projection assembly
GO:0030097	0.653	hemopoiesis
GO:0043067	0.645	regulation of programmed cell death
GO:0042981	0.644	regulation of apoptotic process
GO:0009628	0.631	response to abiotic stimulus
GO:1902017	0.624	regulation of cilium assembly
GO:0007219	0.613	Notch signaling pathway
GO:0051130	0.580	positive regulation of cellular component organization
GO:0001654	0.561	eye development
GO:0009887	0.517	animal organ morphogenesis
GO:0044089	0.474	positive regulation of cellular component biogenesis
GO:0010638	0.335	positive regulation of organelle organization
GO:1902117	0.316	positive regulation of organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005929	0.999	cilium
GO:0005815	0.999	microtubule organizing center
GO:0032991	0.989	protein-containing complex
GO:0036064	0.981	ciliary basal body
GO:0012505	0.908	endomembrane system
GO:0043231	0.893	intracellular membrane-bounded organelle
GO:0005829	0.882	cytosol
GO:0031982	0.788	vesicle
GO:0005813	0.773	centrosome
GO:0097542	0.757	ciliary tip
GO:0016020	0.655	membrane
GO:0030990	0.602	intraciliary transport particle
GO:0030992	0.516	intraciliary transport particle B
GO:0005814	0.495	centriole
GO:0031090	0.478	organelle membrane
GO:0031410	0.465	cytoplasmic vesicle
GO:0099568	0.388	cytoplasmic region
GO:0097014	0.335	ciliary plasm
GO:0005930	0.322	axoneme
GO:0098588	0.308	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]