StarFunc result for job id Q13105

User Input

>input (803 residues)
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPPPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQKEQEEQ
EEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKA
YGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLK
PYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECG
KQFTTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFT
QASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGD
LSKHIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVD
DMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHILYACD
SCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVFRPRD
GAEGQPALAETSPTAPECPPPAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13105	1.000	1.000	0.000	803	1.000	1.000	Q13105.pdb.gz	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
2	AFDB:E7F500	0.307	0.310	1.273E-71	794	0.578	0.584	E7F500.pdb.gz
3	AFDB:P17020	0.280	0.317	2.418E-40	682	0.245	0.289	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
4	AFDB:O95625	0.200	0.161	2.895E-40	1053	0.238	0.181	O95625.pdb.gz	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
5	AFDB:Q9P0L1	0.199	0.211	3.391E-39	754	0.252	0.268	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
6	AFDB:Q14585	0.211	0.337	4.577E-39	488	0.218	0.359	Q14585.pdb.gz	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
7	AFDB:Q9Y2P0	0.221	0.316	6.967E-39	537	0.239	0.358	Q9Y2P0.pdb.gz	ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens OX=9606 GN=ZNF835 PE=1 SV=2
8	AFDB:A0A0U1RQ46	0.233	0.290	8.858E-39	609	0.215	0.284	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
9	AFDB:A6NNF4	0.255	0.274	1.061E-38	738	0.235	0.256	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
10	AFDB:Q08ER8	0.313	0.394	1.614E-38	600	0.249	0.333	Q08ER8.pdb.gz	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
11	PDB:3w5kB	0.068	0.273	2.169E-5	110	0.047	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6wcqC	0.127	0.660	3.722E-5	130	0.040	0.246	6wcqC.pdb.gz
13	PDB:7mk2A	0.109	0.233	2.911E-2	354	0.031	0.071	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
14	PDB:3javA	0.059	0.035	6.352E-2	2327	0.108	0.037	3javA.pdb.gz
15	PDB:7o4iW	0.042	0.081	9.105E-2	312	0.036	0.093	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:6sgaFS	0.086	0.228	1.871E-1	277	0.022	0.065	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
17	PDB:6gypD	0.108	0.486	2.379E-1	151	0.024	0.126	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
18	PDB:2p1nD	0.098	0.498	3.845E-1	127	0.017	0.110	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
19	PDB:6o9lQ	0.043	0.066	4.603E-1	430	0.067	0.126	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
20	PDB:7sszA	0.099	0.202	4.603E-1	362	0.019	0.041	7sszA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13105	0.0	1659	803	1.000	1.000	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
2	Q60821	0.0	1442	794	0.910	0.921	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
3	A6NNF4	2.93e-109	348	616	0.213	0.278	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	Q8TBZ5	8.61e-102	327	544	0.198	0.292	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
5	Q8IYB9	1.30e-101	330	648	0.225	0.279	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
6	Q49A12	1.35e-101	326	536	0.204	0.306	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
7	P17038	5.83e-101	332	809	0.239	0.237	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
8	Q03923	6.83e-101	326	595	0.204	0.276	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
9	Q14585	1.43e-100	322	488	0.222	0.365	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
10	Q8TAQ5	9.85e-100	326	688	0.220	0.257	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
11	O75437	1.93e-99	324	659	0.198	0.241	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
12	P35789	2.48e-99	323	620	0.200	0.260	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
13	Q7TMN8	1.34e-98	319	578	0.229	0.318	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
14	Q05481	1.85e-98	333	1191	0.225	0.152	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
15	Q8BLA2	5.08e-98	318	578	0.228	0.317	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
16	P15620	5.26e-98	318	580	0.235	0.326	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
17	Q6ZN57	6.37e-98	314	461	0.192	0.334	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
18	P17020	9.03e-97	318	682	0.214	0.252	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
19	Q5MCW4	1.03e-96	318	686	0.210	0.246	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
20	Q9UEG4	2.10e-96	322	869	0.214	0.198	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	7.1e-25	98.8	BTB/POZ domain
2	PF00130 C1_1	1.3e+02	13.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
3	PF12833 HTH_18	4.5e+02	12.5	Helix-turn-helix domain
4	PF01155 HypA	2.9e+02	12.9	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
5	PF14000 Packaging_FI	43	16.0	DNA packaging protein FI
6	PF01286 XPA_N	3.2e+02	12.8	XPA protein N-terminal
7	PF02892 zf-BED	0.65	21.4	BED zinc finger
8	PF00096 zf-C2H2	7.2e-55	191.6	Zinc finger, C2H2 type
9	PF16622 zf-C2H2_11	4.6e-15	66.4	zinc-finger C2H2-type
10	PF18868 zf-C2H2_3rep	2.7e+02	13.7	Zinc finger C2H2-type, 3 repeats
11	PF13894 zf-C2H2_4	1.5e-43	154.6	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	0.00088	30.5	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	6.2e-16	69.5	Zinc-finger double-stranded RNA-binding
14	PF13913 zf-C2HC_2	35	15.7	zinc-finger of a C2HC-type
15	PF16278 zf-C2HE	5.3	18.9	C2HE / C2H2 / C2HC zinc-binding finger
16	PF05605 zf-Di19	0.26	22.9	Drought induced 19 protein (Di19), zinc-binding
17	PF13465 zf-H2C2_2	5.5e-70	240.2	Zinc-finger double domain
18	PF13909 zf-H2C2_5	0.00015	32.7	C2H2-type zinc-finger domain
19	PF12874 zf-met	3.7e-06	38.4	Zinc-finger of C2H2 type
20	PF18439 zf_UBZ	2.5	19.1	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364885

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479618	0.999	Myc proto-oncogene protein
2	9606.ENSP00000263253	0.991	Histone acetyltransferase p300
3	9606.ENSP00000264709	0.981	DNA (cytosine-5)-methyltransferase 3A
4	9606.ENSP00000351490	0.945	Protein max
5	9606.ENSP00000268638	0.944	Interferon regulatory factor 8
6	9606.ENSP00000359357	0.929	Zinc finger protein Gfi-1
7	9606.ENSP00000332973	0.907	Mothers against decapentaplegic homolog 3
8	9606.ENSP00000262160	0.905	Mothers against decapentaplegic homolog 2
9	9606.ENSP00000341551	0.905	Mothers against decapentaplegic homolog 4
10	9606.ENSP00000329357	0.903	Transcription factor Sp1
11	9606.ENSP00000216037	0.901	X-box-binding protein 1
12	9606.ENSP00000438262	0.900	Tight junction protein ZO-2
13	9606.ENSP00000260810	0.891	DNA topoisomerase 2-binding protein 1
14	9606.ENSP00000281043	0.811	N-myc proto-oncogene protein
15	9606.ENSP00000384371	0.767	B-cell lymphoma 6 protein
16	9606.ENSP00000269305	0.721	Cellular tumor antigen p53
17	9606.ENSP00000439689	0.703	Transcriptional-regulating factor 1
18	9606.ENSP00000373340	0.695	Peregrin
19	9606.ENSP00000310111	0.661	Heat shock protein family B member 7
20	9606.ENSP00000364742	0.642	F-box only protein 42

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding
GO:1990837	0.982	sequence-specific double-stranded DNA binding
GO:0140110	0.980	transcription regulator activity
GO:0001067	0.973	transcription regulatory region nucleic acid binding
GO:0000976	0.957	transcription cis-regulatory region binding
GO:0003700	0.952	DNA-binding transcription factor activity
GO:0000981	0.929	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.929	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.912	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.887	DNA-binding transcription activator activity
GO:0001228	0.873	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001223	0.855	transcription coactivator binding
GO:0001046	0.822	core promoter sequence-specific DNA binding
GO:0140297	0.733	DNA-binding transcription factor binding
GO:0001217	0.596	DNA-binding transcription repressor activity
GO:0001227	0.470	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0048518	0.977	positive regulation of biological process
GO:0048522	0.957	positive regulation of cellular process
GO:0009893	0.930	positive regulation of metabolic process
GO:0051173	0.912	positive regulation of nitrogen compound metabolic process
GO:0010604	0.912	positive regulation of macromolecule metabolic process
GO:0048519	0.900	negative regulation of biological process
GO:0009987	0.889	cellular process
GO:0031325	0.889	positive regulation of cellular metabolic process
GO:0048523	0.854	negative regulation of cellular process
GO:0009891	0.807	positive regulation of biosynthetic process
GO:0010557	0.783	positive regulation of macromolecule biosynthetic process
GO:0045935	0.780	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.761	regulation of transcription by RNA polymerase II
GO:1903508	0.745	positive regulation of nucleic acid-templated transcription
GO:0045893	0.744	positive regulation of DNA-templated transcription
GO:0045944	0.474	positive regulation of transcription by RNA polymerase II
GO:0009892	0.409	negative regulation of metabolic process
GO:0010605	0.390	negative regulation of macromolecule metabolic process
GO:0051172	0.387	negative regulation of nitrogen compound metabolic process
GO:0031324	0.382	negative regulation of cellular metabolic process
GO:0045892	0.326	negative regulation of DNA-templated transcription
GO:0032502	0.323	developmental process
GO:0048856	0.312	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.992	nucleoplasm
GO:0043232	0.921	intracellular non-membrane-bounded organelle
GO:0032991	0.659	protein-containing complex
GO:0005737	0.652	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]