StarFunc result for job id Q13106

User Input

>input (437 residues)
MAAATLRTPTQGTVTFEDVAVHFSWEEWGLLDEAQRCLYRDVMLENLALLTSLDVHHQKQ
HLGEKHFRSNVGRALFVKTCTFHVSGEPSTCREVGKDFLAKLGFLHQQAAHTGEQSNSKS
DGGAISHRGKTHYNCGEHTKAFSGKHTLVQQQRTLTTERCYICSECGKSFSKSYSLNDHW
RLHTGEKPYECRECGKSFRQSSSLIQHRRVHTAVRPHECDECGKLFSNKSNLIKHRRVHT
GERPYECSECGKSFSQRSALLQHRGVHTGERPYECSECGKFFTYHSSLIKHQKVHSGSRP
YECSECGKSFSQNSSLIEHHRVHTGERPYKCSECGKSFSQRSALLQHRGVHTGERPYECS
ECGKFFPYSSSLRKHQRVHTGSRPYECSECGKSFTQNSGLIKHRRVHTGEKPYECTECGK
SFSHNSSLIKHQRIHSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y2P7	0.563	0.405	1.993E-48	627	0.661	0.461	Q9Y2P7.pdb.gz	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
2	AFDB:Q68DI1	0.578	0.493	3.844E-47	518	0.586	0.494	Q68DI1.pdb.gz	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
3	AFDB:Q8TF45	0.597	0.394	7.189E-47	676	0.609	0.393	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
4	AFDB:Q8TAU3	0.528	0.414	3.342E-46	575	0.595	0.452	Q8TAU3.pdb.gz	ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens OX=9606 GN=ZNF417 PE=1 SV=2
5	AFDB:Q9C0F3	0.552	0.517	1.394E-43	470	0.478	0.445	Q9C0F3.pdb.gz	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
6	AFDB:Q3SY52	0.532	0.480	3.092E-43	487	0.513	0.460	Q3SY52.pdb.gz	ZIK1_HUMAN Zinc finger protein interacting with ribonucleoprotein K OS=Homo sapiens OX=9606 GN=ZIK1 PE=1 SV=1
7	AFDB:Q96HQ0	0.522	0.461	3.882E-43	510	0.570	0.488	Q96HQ0.pdb.gz	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
8	AFDB:Q8BFS8	0.550	0.381	6.859E-43	652	0.490	0.328	Q8BFS8.pdb.gz	ZN418_MOUSE Zinc finger protein 418 OS=Mus musculus OX=10090 GN=ZNF418 PE=2 SV=1
9	AFDB:P52742	0.558	0.385	1.022E-42	658	0.494	0.328	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
10	AFDB:P15622	0.567	0.452	1.145E-42	560	0.476	0.371	P15622.pdb.gz	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
11	PDB:3w5kB	0.105	0.273	2.837E-4	110	0.085	0.336	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5c8dE	0.074	0.097	7.738E-1	280	0.053	0.082	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
13	PDB:7o4iW	0.058	0.074	1.292	312	0.092	0.128	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:7ena4	0.072	0.071	1.367	457	0.064	0.061	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:6ff4t	0.055	0.122	1.622	172	0.050	0.128	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:6gejS	0.068	0.112	1.817	208	0.078	0.163	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:7dvqM	0.049	0.101	2.282	191	0.069	0.157	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:2p01A	0.082	0.096	2.416	323	0.092	0.124	2p01A.pdb.gz
19	PDB:6id0L	0.087	0.081	2.416	475	0.105	0.097	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:6n8jb	0.069	0.051	3.211	647	0.117	0.079	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y2P7	2.51e-174	504	627	0.581	0.405	ZN256_HUMAN Zinc finger protein 256 OS=Homo sapiens OX=9606 GN=ZNF256 PE=1 SV=2
2	Q8TF45	3.60e-156	459	676	0.551	0.357	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
3	Q96HQ0	1.76e-152	444	510	0.542	0.465	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
4	Q6PK81	1.11e-150	437	442	0.542	0.536	ZN773_HUMAN Zinc finger protein 773 OS=Homo sapiens OX=9606 GN=ZNF773 PE=1 SV=1
5	Q68DI1	6.61e-147	430	518	0.490	0.413	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
6	Q9C0F3	2.99e-143	419	470	0.503	0.468	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
7	Q96SQ5	9.60e-142	419	575	0.501	0.381	ZN587_HUMAN Zinc finger protein 587 OS=Homo sapiens OX=9606 GN=ZNF587 PE=1 SV=1
8	P17021	2.31e-141	421	662	0.513	0.338	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
9	Q8TAU3	2.34e-141	418	575	0.497	0.377	ZN417_HUMAN Zinc finger protein 417 OS=Homo sapiens OX=9606 GN=ZNF417 PE=1 SV=2
10	Q3KQV3	1.84e-140	417	632	0.481	0.332	ZN792_HUMAN Zinc finger protein 792 OS=Homo sapiens OX=9606 GN=ZNF792 PE=1 SV=2
11	Q9HCX3	2.05e-135	405	659	0.490	0.325	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
12	Q8TAQ5	5.94e-134	402	688	0.506	0.321	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
13	P17020	1.08e-133	402	682	0.453	0.290	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
14	F8WEZ9	6.00e-133	393	492	0.451	0.400	F8WEZ9_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=1
15	P52742	1.52e-131	395	658	0.481	0.319	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
16	Q8NA42	1.98e-131	389	475	0.462	0.425	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
17	Q6ZN57	6.15e-131	387	461	0.453	0.430	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
18	Q8NCK3	1.83e-130	385	441	0.439	0.435	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
19	P17030	3.66e-130	385	456	0.467	0.447	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
20	P17036	5.08e-130	384	446	0.465	0.455	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	2.9e-06	38.4	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03604 DNA_RNApol_7kD	1.8e+02	13.3	DNA directed RNA polymerase, 7 kDa subunit
3	PF19553 DUF6076	0.082	24.1	Family of unknown function (DUF6076)
4	PF19817 DUF6300	85	14.7	Family of unknown function (DUF6300)
5	PF18547 HalOD2	6.6e+02	11.6	Halobacterial output domain 2
6	PF01352 KRAB	1e-19	81.1	KRAB box
7	PF00412 LIM	24	16.6	LIM domain
8	PF01096 TFIIS_C	0.98	20.6	Transcription factor S-II (TFIIS)
9	PF01286 XPA_N	2.4e-06	38.8	XPA protein N-terminal
10	PF14149 YhfH	0.002	29.3	YhfH-like protein
11	PF00096 zf-C2H2	7.5e-58	201.0	Zinc finger, C2H2 type
12	PF16622 zf-C2H2_11	2.3e-07	41.8	zinc-finger C2H2-type
13	PF13894 zf-C2H2_4	2.7e-33	122.7	C2H2-type zinc finger
14	PF13912 zf-C2H2_6	8e-26	100.7	C2H2-type zinc finger
15	PF12171 zf-C2H2_jaz	2.4e-14	64.4	Zinc-finger double-stranded RNA-binding
16	PF13465 zf-H2C2_2	3.6e-76	259.7	Zinc-finger double domain
17	PF12874 zf-met	0.056	25.1	Zinc-finger of C2H2 type
18	PF18439 zf_UBZ	8.2e-12	55.9	Ubiquitin-Binding Zinc Finger
19	PF17032 zinc_ribbon_15	0.00042	32.4	zinc-ribbon family
20	PF09723 Zn-ribbon_8	0.00011	33.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351345	0.769	ALK and LTK ligand 1
2	9606.ENSP00000432561	0.769	Histatin-3
3	9606.ENSP00000439287	0.737	Regulating synaptic membrane exocytosis protein 4
4	9606.ENSP00000390661	0.618	C-type lectin domain family 2 member L
5	9606.ENSP00000396421	0.603	NXPE family member 3
6	9606.ENSP00000253807	0.562	Protocadherin alpha-C1
7	9606.ENSP00000281156	0.561	KH domain-containing, RNA-binding, signal transduction-associated protein 2
8	9606.ENSP00000361345	0.560	Protein FAM78A
9	9606.ENSP00000412365	0.550	Cyclin-dependent kinase-like 2
10	9606.ENSP00000353796	0.542	Ankyrin repeat domain-containing protein 53
11	9606.ENSP00000369419	0.516	Metalloreductase STEAP4
12	9606.ENSP00000281321	0.509	POU domain, class 4, transcription factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0019222	0.917	regulation of metabolic process
GO:0060255	0.902	regulation of macromolecule metabolic process
GO:0051171	0.875	regulation of nitrogen compound metabolic process
GO:0080090	0.870	regulation of primary metabolic process
GO:0010556	0.856	regulation of macromolecule biosynthetic process
GO:0031323	0.840	regulation of cellular metabolic process
GO:0048519	0.785	negative regulation of biological process
GO:0010468	0.761	regulation of gene expression
GO:0048523	0.730	negative regulation of cellular process
GO:0010558	0.730	negative regulation of macromolecule biosynthetic process
GO:0031326	0.725	regulation of cellular biosynthetic process
GO:0051252	0.719	regulation of RNA metabolic process
GO:0051172	0.581	negative regulation of nitrogen compound metabolic process
GO:0031324	0.581	negative regulation of cellular metabolic process
GO:0009987	0.568	cellular process
GO:0006355	0.540	regulation of DNA-templated transcription
GO:0031327	0.470	negative regulation of cellular biosynthetic process
GO:1902679	0.448	negative regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.862	cytoplasm
GO:0071944	0.386	cell periphery
GO:0016020	0.358	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]