StarFunc result for job id Q13107

User Input

>input (963 residues)
MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRN
FTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPG
LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRVMEVFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYN
HRFHKIFQMDEGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASAL
YGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACNGSRNSCEGED
EEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADI
NSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKKTTVALRD
CIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT
VVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS
NVSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQGFGDDEACSM
DTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R2X6	0.749	0.783	0.000	916	0.950	0.999	A0A024R2X6.pdb.gz
2	AFDB:A1LPW7	0.818	0.818	0.000	963	1.000	1.000	A1LPW7.pdb.gz
3	AFDB:E7EZD6	0.796	0.761	0.000	1009	0.701	0.669	E7EZD6.pdb.gz	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
4	AFDB:P51784	0.530	0.530	0.000	963	0.449	0.449	P51784.pdb.gz	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
5	AFDB:Q5D006	0.527	0.548	0.000	921	0.455	0.476	Q5D006.pdb.gz	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
6	AFDB:Q8R5H1	0.739	0.727	0.000	981	0.585	0.574	Q8R5H1.pdb.gz	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
7	AFDB:Q9R085	0.774	0.782	0.000	952	0.578	0.585	Q9R085.pdb.gz	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
8	AFDB:O22207	0.420	0.436	1.305E-85	924	0.344	0.358	O22207.pdb.gz	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
9	AFDB:O60079	0.653	0.643	6.062E-77	979	0.298	0.293	O60079.pdb.gz	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
10	AFDB:Q8NFA0	0.483	0.308	5.436E-70	1604	0.300	0.180	Q8NFA0.pdb.gz	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
11	PDB:3mhsA	0.272	0.549	2.127E-20	455	0.101	0.213	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:5cvnB	0.271	0.764	2.014E-19	321	0.093	0.280	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:5k16B	0.264	0.727	9.350E-18	328	0.096	0.280	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:4fjcE	0.244	0.519	2.375E-16	434	0.099	0.219	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
15	PDB:4wa6D	0.255	0.567	3.486E-15	415	0.090	0.210	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:7yxxA	0.261	0.149	7.111E-14	1754	0.097	0.053	7yxxA.pdb.gz
17	PDB:7ay1D	0.262	0.678	9.880E-14	341	0.093	0.264	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
18	PDB:7w3ax	0.261	0.488	7.512E-13	494	0.104	0.202	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
19	PDB:8a9kD	0.225	0.687	7.935E-13	285	0.079	0.267	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
20	PDB:5k1bA	0.234	0.819	2.015E-12	264	0.096	0.348	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EZD6	0.0	1317	1009	0.694	0.662	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
2	G5E9A6	0.0	758	920	0.444	0.465	G5E9A6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=1
3	H7C189	0.0	1289	621	0.644	0.998	H7C189_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=1
4	P35123	0.0	1783	962	0.908	0.909	UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3
5	P51784	0.0	758	963	0.444	0.444	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
6	Q13107	0.0	2017	963	1.000	1.000	UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3
7	Q5D006	0.0	780	921	0.453	0.473	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
8	Q8R5H1	0.0	1105	981	0.583	0.572	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
9	Q9R085	0.0	1100	952	0.578	0.585	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
10	Q9Y4E8	0.0	1109	981	0.587	0.576	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
11	O22207	3.29e-165	509	924	0.345	0.359	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
12	F1RCS0	1.08e-126	419	1436	0.277	0.186	F1RCS0_DANRE Ubiquitin carboxyl-terminal hydrolase 19 isoform X3 OS=Danio rerio OX=7955 GN=usp19 PE=1 SV=1
13	O94966	3.64e-120	399	1318	0.273	0.200	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2
14	K7EQL6	5.63e-79	283	1274	0.187	0.141	K7EQL6_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
15	Q3UJD6	9.38e-79	283	1360	0.145	0.103	UBP19_MOUSE Ubiquitin carboxyl-terminal hydrolase 19 OS=Mus musculus OX=10090 GN=Usp19 PE=1 SV=1
16	Q8NFA0	1.35e-78	283	1604	0.189	0.113	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
17	Q6J1Y9	5.09e-78	280	1357	0.140	0.099	UBP19_RAT Ubiquitin carboxyl-terminal hydrolase 19 OS=Rattus norvegicus OX=10116 GN=Usp19 PE=1 SV=1
18	O60079	1.19e-76	273	979	0.148	0.146	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
19	P35125	1.13e-71	262	1406	0.125	0.085	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2
20	Q9USM5	1.14e-67	245	849	0.202	0.230	UBP1_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20097 DUF6487	3.9e+02	12.8	Domain of unknown function (DUF6487)
2	PF06337 DUSP	1.3e-19	81.9	DUSP domain
3	PF14836 Ubiquitin_3	3.7e-29	111.9	Ubiquitin-like domain
4	PF00443 UCH	2.2e-89	311.3	Ubiquitin carboxyl-terminal hydrolase
5	PF13423 UCH_1	1.2e-07	43.3	Ubiquitin carboxyl-terminal hydrolase
6	PF14533 USP7_C2	0.039	25.2	Ubiquitin-specific protease C-terminal
7	PF12436 USP7_ICP0_bdg	1.4	19.8	ICP0-binding domain of Ubiquitin-specific protease 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265560

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228284	0.997	Squamous cell carcinoma antigen recognized by T-cells 3
2	9606.ENSP00000441543	0.980	Polyubiquitin-C
3	9606.ENSP00000433623	0.975	TNF receptor-associated factor 6
4	9606.ENSP00000382628	0.966	DNA endonuclease RBBP8
5	9606.ENSP00000259808	0.962	Receptor-interacting serine/threonine-protein kinase 1
6	9606.ENSP00000358335	0.943	Mitogen-activated protein kinase kinase kinase 7
7	9606.ENSP00000430684	0.941	Inhibitor of nuclear factor kappa-B kinase subunit beta
8	9606.ENSP00000216160	0.935	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
9	9606.ENSP00000368215	0.935	TGF-beta-activated kinase 1 and MAP3K7-binding protein 3
10	9606.ENSP00000356426	0.933	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
11	9606.ENSP00000483825	0.932	NF-kappa-B essential modulator
12	9606.ENSP00000162749	0.930	Tumor necrosis factor receptor superfamily member 1A
13	9606.ENSP00000315112	0.927	E3 ubiquitin-protein ligase RNF31
14	9606.ENSP00000348632	0.924	RanBP-type and C3HC4-type zinc finger-containing protein 1
15	9606.ENSP00000254436	0.923	E3 ubiquitin-protein ligase TRIM21
16	9606.ENSP00000477613	0.923	Baculoviral IAP repeat-containing protein 2
17	9606.ENSP00000304697	0.921	Polyubiquitin-B
18	9606.ENSP00000381698	0.921	Sharpin
19	9606.ENSP00000359424	0.920	Inhibitor of nuclear factor kappa-B kinase subunit alpha
20	9606.ENSP00000398698	0.918	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0042802	0.821	identical protein binding
GO:0005102	0.538	signaling receptor binding
GO:0004175	0.356	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006508	0.995	proteolysis
GO:0036211	0.982	protein modification process
GO:0016579	0.964	protein deubiquitination
GO:0050789	0.889	regulation of biological process
GO:0009987	0.730	cellular process
GO:0050794	0.605	regulation of cellular process
GO:0019222	0.472	regulation of metabolic process
GO:0048583	0.439	regulation of response to stimulus
GO:0060255	0.437	regulation of macromolecule metabolic process
GO:0051171	0.413	regulation of nitrogen compound metabolic process
GO:0044237	0.390	cellular metabolic process
GO:0080090	0.385	regulation of primary metabolic process
GO:0048519	0.375	negative regulation of biological process
GO:0048518	0.316	positive regulation of biological process
GO:0048522	0.308	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.996	plasma membrane
GO:0043231	0.935	intracellular membrane-bounded organelle
GO:0005634	0.859	nucleus
GO:0032991	0.397	protein-containing complex
GO:0031981	0.394	nuclear lumen
GO:0005654	0.375	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]