StarFunc result for job id Q13114

User Input

>input (568 residues)
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13114	1.000	1.000	0.000	568	1.000	1.000	Q13114.pdb.gz	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
2	AFDB:Q6DEG0	0.403	0.400	9.295E-74	573	0.563	0.558	Q6DEG0.pdb.gz	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
3	AFDB:P70191	0.331	0.336	2.852E-62	558	0.419	0.427	P70191.pdb.gz	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
4	AFDB:O00463	0.329	0.336	7.128E-62	557	0.403	0.411	O00463.pdb.gz	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
5	AFDB:P39429	0.329	0.371	1.428E-48	501	0.320	0.363	P39429.pdb.gz	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
6	AFDB:A0A024R8H5	0.334	0.378	2.969E-47	501	0.324	0.367	A0A024R8H5.pdb.gz
7	AFDB:Q7T1K2	0.268	0.323	2.162E-40	470	0.245	0.296	Q7T1K2.pdb.gz	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
8	AFDB:Q9Y4K3	0.295	0.319	4.759E-39	522	0.245	0.266	Q9Y4K3.pdb.gz	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
9	AFDB:A0A024QZ59	0.276	0.330	7.105E-39	470	0.241	0.291	A0A024QZ59.pdb.gz
10	AFDB:Q6DJN2	0.301	0.307	3.958E-38	556	0.250	0.255	Q6DJN2.pdb.gz	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
11	PDB:5dkaA	0.133	0.657	1.574E-4	96	0.039	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
12	PDB:4r8pL	0.110	0.235	8.661E-3	254	0.049	0.110	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:7bhqB	0.073	0.162	1.293E-2	204	0.056	0.157	7bhqB.pdb.gz
14	PDB:6l4cB	0.060	0.082	6.066E-2	373	0.028	0.043	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
15	PDB:2et1A	0.070	0.147	6.802E-2	201	0.033	0.095	2et1A.pdb.gz	Structural and spectroscopic studies shed light on the mechanism of oxalate oxidase
16	PDB:7jzvA	0.103	0.226	6.802E-2	253	0.028	0.063	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
17	PDB:3b2dC	0.096	0.266	7.627E-2	139	0.039	0.158	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:5gm6a	0.077	0.329	9.056E-2	123	0.030	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:3wsoA	0.080	0.150	1.016E-1	252	0.026	0.060	3wsoA.pdb.gz
20	PDB:7z8bC	0.101	0.056	1.075E-1	1224	0.030	0.014	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13114	0.0	1182	568	1.000	1.000	TRAF3_HUMAN TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2
2	Q60803	0.0	1136	567	0.961	0.963	TRAF3_MOUSE TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2
3	Q6DEG0	0.0	671	573	0.563	0.558	Q6DEG0_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=zgc:92367 PE=2 SV=1
4	P70191	1.16e-160	471	558	0.426	0.434	TRAF5_MOUSE TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1
5	O00463	8.97e-152	449	557	0.408	0.417	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
6	P39429	3.01e-94	299	501	0.335	0.379	TRAF2_MOUSE TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1
7	B5DFH7	2.20e-92	294	497	0.331	0.378	B5DFH7_RAT TNF receptor-associated factor OS=Rattus norvegicus OX=10116 GN=Traf2 PE=1 SV=1
8	Q12933	2.22e-91	291	501	0.327	0.371	TRAF2_HUMAN TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2
9	Q13077	1.12e-71	237	416	0.264	0.361	TRAF1_HUMAN TNF receptor-associated factor 1 OS=Homo sapiens OX=9606 GN=TRAF1 PE=1 SV=1
10	P39428	1.28e-70	234	409	0.268	0.372	TRAF1_MOUSE TNF receptor-associated factor 1 OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=2
11	Q4VA12	1.22e-69	232	409	0.266	0.369	Q4VA12_MOUSE TNF receptor-associated factor OS=Mus musculus OX=10090 GN=Traf1 PE=1 SV=1
12	Q6IWL4	4.80e-56	199	542	0.259	0.271	TRAF6_DANRE TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2
13	B5DF45	1.26e-51	187	530	0.241	0.258	TRAF6_RAT TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1
14	Q9Y4K3	1.35e-51	187	522	0.246	0.268	TRAF6_HUMAN TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1
15	E1C626	1.53e-51	187	545	0.239	0.250	E1C626_CHICK TNF receptor-associated factor OS=Gallus gallus OX=9031 GN=TRAF6 PE=1 SV=2
16	Q6DJN2	1.92e-51	187	556	0.262	0.268	TRF6B_XENLA TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1
17	P70196	2.54e-50	183	530	0.238	0.255	TRAF6_MOUSE TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2
18	Q3MV19	7.18e-50	182	556	0.264	0.270	TRF6A_XENLA TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1
19	Q7T1K2	2.17e-45	168	470	0.255	0.309	Q7T1K2_DANRE TNF receptor-associated factor OS=Danio rerio OX=7955 GN=traf4l PE=2 SV=1
20	Q9BUZ4	6.20e-42	159	470	0.246	0.298	TRAF4_HUMAN TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	76	15.0	Autophagy protein 16 (ATG16)
2	PF10174 Cast	30	14.3	RIM-binding protein of the cytomatrix active zone
3	PF19220 Crescentin	2.1e+02	12.3	Crescentin protein
4	PF07889 DUF1664	6.9e+02	11.7	Protein of unknown function (DUF1664)
5	PF02601 Exonuc_VII_L	5.3e+02	11.5	Exonuclease VII, large subunit
6	PF02050 FliJ	5.9e+02	12.1	Flagellar FliJ protein
7	PF13851 GAS	4.3e+02	11.7	Growth-arrest specific micro-tubule binding
8	PF10241 KxDL	2.2e+02	13.5	Uncharacterized conserved protein
9	PF17060 MPS2	29	15.6	Monopolar spindle protein 2
10	PF17082 Spc29	46	15.3	Spindle Pole Component 29
11	PF12718 Tropomyosin_1	30	16.2	Tropomyosin like
12	PF00097 zf-C3HC4	9.9	17.4	Zinc finger, C3HC4 type (RING finger)
13	PF13923 zf-C3HC4_2	46	15.3	Zinc finger, C3HC4 type (RING finger)
14	PF02176 zf-TRAF	1.3e-21	88.4	TRAF-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000228918	0.999	Tumor necrosis factor receptor superfamily member 3
2	9606.ENSP00000291232	0.999	Tumor necrosis factor receptor superfamily member 13C
3	9606.ENSP00000329967	0.999	Serine/threonine-protein kinase TBK1
4	9606.ENSP00000361359	0.999	Tumor necrosis factor receptor superfamily member 5
5	9606.ENSP00000376505	0.999	TRAF family member-associated NF-kappa-B activator
6	9606.ENSP00000401980	0.999	Mitochondrial antiviral-signaling protein
7	9606.ENSP00000477613	0.999	Baculoviral IAP repeat-containing protein 2
8	9606.ENSP00000248244	0.998	TIR domain-containing adapter molecule 1
9	9606.ENSP00000263464	0.998	Baculoviral IAP repeat-containing protein 3
10	9606.ENSP00000401399	0.997	Myeloid differentiation primary response protein MyD88
11	9606.ENSP00000464030	0.996	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
12	9606.ENSP00000482657	0.995	Mitogen-activated protein kinase kinase kinase 14
13	9606.ENSP00000220751	0.994	Receptor-interacting serine/threonine-protein kinase 2
14	9606.ENSP00000363089	0.994	Toll-like receptor 4
15	9606.ENSP00000341268	0.991	Tumor necrosis factor receptor type 1-associated DEATH domain protein
16	9606.ENSP00000359424	0.991	Inhibitor of nuclear factor kappa-B kinase subunit alpha
17	9606.ENSP00000156084	0.988	OTU domain-containing protein 5
18	9606.ENSP00000261464	0.988	TNF receptor-associated factor 5
19	9606.ENSP00000407586	0.988	GTPase HRas
20	9606.ENSP00000358997	0.987	Interleukin-1 receptor-associated kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	1.000	enzyme binding
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0004842	0.993	ubiquitin-protein transferase activity
GO:0042802	0.987	identical protein binding
GO:0005164	0.987	tumor necrosis factor receptor binding
GO:0031625	0.983	ubiquitin protein ligase binding
GO:0019903	0.966	protein phosphatase binding
GO:0031996	0.779	thioesterase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.997	positive regulation of biological process
GO:0023052	0.996	signaling
GO:0051716	0.996	cellular response to stimulus
GO:0048583	0.996	regulation of response to stimulus
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0007165	0.994	signal transduction
GO:0051090	0.990	regulation of DNA-binding transcription factor activity
GO:0050778	0.988	positive regulation of immune response
GO:0031349	0.986	positive regulation of defense response
GO:0002376	0.985	immune system process
GO:0034097	0.985	response to cytokine
GO:0002831	0.985	regulation of response to biotic stimulus
GO:0032103	0.985	positive regulation of response to external stimulus
GO:0007166	0.984	cell surface receptor signaling pathway
GO:0071310	0.982	cellular response to organic substance
GO:0002253	0.970	activation of immune response
GO:0045089	0.969	positive regulation of innate immune response
GO:0002218	0.961	activation of innate immune response
GO:0071345	0.960	cellular response to cytokine stimulus
GO:0019221	0.953	cytokine-mediated signaling pathway
GO:0002764	0.946	immune response-regulating signaling pathway
GO:0002758	0.931	innate immune response-activating signaling pathway
GO:0044092	0.914	negative regulation of molecular function
GO:0051246	0.914	regulation of protein metabolic process
GO:0002221	0.898	pattern recognition receptor signaling pathway
GO:0043433	0.846	negative regulation of DNA-binding transcription factor activity
GO:0032088	0.841	negative regulation of NF-kappaB transcription factor activity
GO:0071356	0.840	cellular response to tumor necrosis factor
GO:0033209	0.833	tumor necrosis factor-mediated signaling pathway
GO:0002224	0.833	toll-like receptor signaling pathway
GO:0048522	0.683	positive regulation of cellular process
GO:0009893	0.528	positive regulation of metabolic process
GO:0010604	0.507	positive regulation of macromolecule metabolic process
GO:0051239	0.475	regulation of multicellular organismal process
GO:0001817	0.437	regulation of cytokine production
GO:0023051	0.393	regulation of signaling
GO:0010646	0.389	regulation of cell communication
GO:0044093	0.378	positive regulation of molecular function
GO:0009605	0.376	response to external stimulus
GO:0048519	0.371	negative regulation of biological process
GO:0009966	0.358	regulation of signal transduction
GO:0009607	0.355	response to biotic stimulus
GO:0030162	0.351	regulation of proteolysis
GO:0044419	0.344	biological process involved in interspecies interaction between organisms

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0005886	0.992	plasma membrane
GO:0005829	0.990	cytosol
GO:0032991	0.986	protein-containing complex
GO:0043231	0.827	intracellular membrane-bounded organelle
GO:0005634	0.646	nucleus
GO:0098796	0.491	membrane protein complex
GO:0043235	0.370	receptor complex
GO:0098552	0.359	side of membrane
GO:0098797	0.358	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.993	Transferases.

[back to server]