StarFunc result for job id Q13115

User Input

>input (394 residues)
MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGY
ILGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLRE
DSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLD
LGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGHY
QYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKKR
VRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPLRERGKTPATP
TSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q62767	0.928	0.926	2.249E-78	395	0.964	0.962	Q62767.pdb.gz	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
2	AFDB:A0A2R8QPP3	0.778	0.833	5.484E-59	367	0.678	0.728	A0A2R8QPP3.pdb.gz
3	AFDB:Q91790	0.412	0.438	2.019E-53	369	0.602	0.642	Q91790.pdb.gz	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
4	AFDB:P28562	0.706	0.755	2.752E-53	367	0.591	0.635	P28562.pdb.gz	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
5	AFDB:Q05922	0.703	0.861	3.687E-41	318	0.404	0.500	Q05922.pdb.gz	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
6	AFDB:O54838	0.387	0.396	4.723E-41	384	0.426	0.438	O54838.pdb.gz	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
7	AFDB:Q05923	0.682	0.840	4.388E-40	314	0.401	0.503	Q05923.pdb.gz	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
8	AFDB:O09112	0.377	0.227	2.288E-32	663	0.289	0.172	O09112.pdb.gz	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
9	AFDB:A0A024RAR2	0.359	0.215	7.801E-31	665	0.284	0.168	A0A024RAR2.pdb.gz
10	AFDB:Q99956	0.383	0.393	9.993E-31	384	0.330	0.339	Q99956.pdb.gz	DUS9_HUMAN Dual specificity protein phosphatase 9 OS=Homo sapiens OX=9606 GN=DUSP9 PE=1 SV=1
11	PDB:6d66A	0.366	0.279	1.698E-26	517	0.310	0.236	6d66A.pdb.gz
12	PDB:2esbA	0.353	0.847	3.019E-17	162	0.129	0.315	2esbA.pdb.gz
13	PDB:2wgpA	0.353	0.819	4.378E-17	168	0.145	0.339	2wgpA.pdb.gz
14	PDB:5y15A	0.350	0.910	6.127E-14	148	0.117	0.311	5y15A.pdb.gz
15	PDB:2gwoC	0.334	0.736	1.125E-12	174	0.132	0.299	2gwoC.pdb.gz
16	PDB:3f81A	0.334	0.716	2.223E-12	179	0.124	0.274	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
17	PDB:5xjvB	0.329	0.737	1.424E-11	171	0.129	0.298	5xjvB.pdb.gz
18	PDB:2y96A	0.329	0.714	1.715E-11	175	0.127	0.286	2y96A.pdb.gz
19	PDB:2q05A	0.307	0.639	6.540E-9	181	0.089	0.193	2q05A.pdb.gz
20	PDB:4ercA	0.297	0.738	3.075E-8	150	0.058	0.153	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13115	0.0	808	394	1.000	1.000	DUS4_HUMAN Dual specificity protein phosphatase 4 OS=Homo sapiens OX=9606 GN=DUSP4 PE=1 SV=1
2	Q62767	0.0	774	395	0.964	0.962	DUS4_RAT Dual specificity protein phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Dusp4 PE=1 SV=1
3	Q7SZF3	0.0	539	367	0.678	0.728	Q7SZF3_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=zgc:55423 PE=2 SV=1
4	P28562	1.21e-164	468	367	0.581	0.624	DUS1_HUMAN Dual specificity protein phosphatase 1 OS=Homo sapiens OX=9606 GN=DUSP1 PE=1 SV=3
5	Q64623	2.05e-163	464	367	0.579	0.621	DUS1_RAT Dual specificity protein phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Dusp1 PE=1 SV=1
6	P28563	4.45e-163	464	367	0.579	0.621	DUS1_MOUSE Dual specificity protein phosphatase 1 OS=Mus musculus OX=10090 GN=Dusp1 PE=1 SV=1
7	Q91790	2.32e-160	457	369	0.612	0.653	DUS1A_XENLA Dual specificity protein phosphatase 1-A OS=Xenopus laevis OX=8355 GN=dusp1-a PE=1 SV=1
8	Q05922	1.36e-95	290	318	0.391	0.484	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
9	Q05923	4.72e-94	286	314	0.411	0.516	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
10	Q16690	4.27e-90	278	384	0.452	0.464	DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens OX=9606 GN=DUSP5 PE=1 SV=2
11	O54838	5.54e-89	275	384	0.439	0.451	DUS5_RAT Dual specificity protein phosphatase 5 OS=Rattus norvegicus OX=10116 GN=Dusp5 PE=2 SV=1
12	Q7T2L8	8.84e-51	176	382	0.297	0.306	Q7T2L8_DANRE Dual specificity protein phosphatase OS=Danio rerio OX=7955 GN=mkp3 PE=2 SV=1
13	Q16829	1.59e-50	177	419	0.297	0.279	DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens OX=9606 GN=DUSP7 PE=1 SV=4
14	Q9DBB1	1.73e-45	162	381	0.307	0.318	DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus OX=10090 GN=Dusp6 PE=1 SV=1
15	Q9BY84	1.78e-45	168	665	0.244	0.144	DUS16_HUMAN Dual specificity protein phosphatase 16 OS=Homo sapiens OX=9606 GN=DUSP16 PE=1 SV=1
16	D4A3W6	2.03e-45	167	661	0.241	0.144	D4A3W6_RAT Dual specificity phosphatase 16 OS=Rattus norvegicus OX=10116 GN=Dusp16 PE=1 SV=1
17	Q16828	2.86e-45	162	381	0.297	0.307	DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens OX=9606 GN=DUSP6 PE=1 SV=2
18	Q64346	6.45e-45	161	381	0.305	0.315	DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus OX=10116 GN=Dusp6 PE=1 SV=1
19	O09112	1.13e-44	166	663	0.256	0.152	DUS8_MOUSE Dual specificity protein phosphatase 8 OS=Mus musculus OX=10090 GN=Dusp8 PE=2 SV=1
20	Q9Y6W6	1.72e-44	162	482	0.261	0.214	DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens OX=9606 GN=DUSP10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05706 CDKN3	1.7e+02	13.3	Cyclin-dependent kinase inhibitor 3 (CDKN3)
2	PF00782 DSPc	8.7e-42	153.5	Dual specificity phosphatase, catalytic domain
3	PF14566 PTPlike_phytase	4.7e+02	12.3	Inositol hexakisphosphate
4	PF00581 Rhodanese	6.2e-07	41.3	Rhodanese-like domain
5	PF00102 Y_phosphatase	0.027	25.6	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240100

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263025	0.986	Mitogen-activated protein kinase 3
2	9606.ENSP00000215832	0.984	Mitogen-activated protein kinase 1
3	9606.ENSP00000378974	0.981	Mitogen-activated protein kinase 8
4	9606.ENSP00000229795	0.978	Mitogen-activated protein kinase 14
5	9606.ENSP00000311005	0.942	Mitogen-activated protein kinase 7
6	9606.ENSP00000279488	0.919	Dual specificity protein phosphatase 6
7	9606.ENSP00000380530	0.916	Dual specificity protein phosphatase 8
8	9606.ENSP00000345853	0.912	Dual specificity protein phosphatase 9
9	9606.ENSP00000394560	0.907	Mitogen-activated protein kinase 9
10	9606.ENSP00000288943	0.905	Dual specificity protein phosphatase 2
11	9606.ENSP00000239223	0.902	Dual specificity protein phosphatase 1
12	9606.ENSP00000215659	0.779	Mitogen-activated protein kinase 12
13	9606.ENSP00000333685	0.740	Mitogen-activated protein kinase 11
14	9606.ENSP00000452414	0.734	Protein tyrosine phosphatase, non-receptor type 21
15	9606.ENSP00000352157	0.727	Mitogen-activated protein kinase 10
16	9606.ENSP00000211287	0.725	Mitogen-activated protein kinase 13
17	9606.ENSP00000254667	0.675	Receptor-type tyrosine-protein phosphatase epsilon
18	9606.ENSP00000369756	0.667	Receptor-type tyrosine-protein phosphatase alpha
19	9606.ENSP00000344967	0.662	Protein sprouty homolog 4
20	9606.ENSP00000283228	0.649	Receptor-type tyrosine-protein phosphatase R

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033549	1.000	MAP kinase phosphatase activity
GO:0008138	1.000	protein tyrosine/serine/threonine phosphatase activity
GO:0005515	0.997	protein binding
GO:0004725	0.815	protein tyrosine phosphatase activity
GO:0008330	0.427	protein tyrosine/threonine phosphatase activity
GO:0017017	0.401	MAP kinase tyrosine/serine/threonine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.999	cellular metabolic process
GO:0050794	0.996	regulation of cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0006796	0.989	phosphate-containing compound metabolic process
GO:0048583	0.981	regulation of response to stimulus
GO:0023051	0.980	regulation of signaling
GO:0010646	0.979	regulation of cell communication
GO:0006807	0.976	nitrogen compound metabolic process
GO:0048519	0.976	negative regulation of biological process
GO:0048523	0.969	negative regulation of cellular process
GO:1902531	0.969	regulation of intracellular signal transduction
GO:0043170	0.966	macromolecule metabolic process
GO:0043408	0.960	regulation of MAPK cascade
GO:0016311	0.956	dephosphorylation
GO:1901564	0.955	organonitrogen compound metabolic process
GO:0043412	0.954	macromolecule modification
GO:0019538	0.954	protein metabolic process
GO:0036211	0.938	protein modification process
GO:0023057	0.930	negative regulation of signaling
GO:0010648	0.927	negative regulation of cell communication
GO:0048585	0.926	negative regulation of response to stimulus
GO:0043409	0.924	negative regulation of MAPK cascade
GO:0006470	0.901	protein dephosphorylation
GO:0050896	0.820	response to stimulus
GO:0051716	0.683	cellular response to stimulus
GO:0019222	0.657	regulation of metabolic process
GO:0031323	0.497	regulation of cellular metabolic process
GO:0051171	0.484	regulation of nitrogen compound metabolic process
GO:0060255	0.481	regulation of macromolecule metabolic process
GO:0080090	0.444	regulation of primary metabolic process
GO:0007154	0.412	cell communication
GO:0023052	0.410	signaling
GO:0007165	0.396	signal transduction
GO:0048518	0.394	positive regulation of biological process
GO:0048522	0.330	positive regulation of cellular process
GO:0042221	0.314	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.958	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:10684	0.815	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.815	protein-tyrosine-phosphatase.

[back to server]