StarFunc result for job id Q13117

User Input

>input (558 residues)
MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCF
GRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLC
ARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVIT
GCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAF
PAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVAT
GYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAF
PAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTT
GYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAF
PAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNL
WTEAYKWWYLVCLIQRRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13117	1.000	1.000	2.051E-79	558	1.000	1.000	Q13117.pdb.gz	DAZ2_HUMAN Deleted in azoospermia protein 2 OS=Homo sapiens OX=9606 GN=DAZ2 PE=1 SV=3
2	AFDB:Q9NQZ3	0.327	0.249	3.232E-42	744	0.735	0.551	Q9NQZ3.pdb.gz	DAZ1_HUMAN Deleted in azoospermia protein 1 OS=Homo sapiens OX=9606 GN=DAZ1 PE=1 SV=2
3	AFDB:Q92904	0.169	0.314	1.046E-16	295	0.290	0.549	Q92904.pdb.gz	DAZL_HUMAN Deleted in azoospermia-like OS=Homo sapiens OX=9606 GN=DAZL PE=1 SV=1
4	AFDB:Q64368	0.166	0.304	3.266E-16	298	0.272	0.510	Q64368.pdb.gz	DAZL_MOUSE Deleted in azoospermia-like OS=Mus musculus OX=10090 GN=Dazl PE=1 SV=1
5	AFDB:Q76CY5	0.189	0.357	4.051E-12	286	0.186	0.364	Q76CY5.pdb.gz	DAZL_XENTR Deleted in azoospermia-like OS=Xenopus tropicalis OX=8364 GN=dazl PE=2 SV=1
6	AFDB:O57437	0.159	0.305	4.132E-11	286	0.179	0.350	O57437.pdb.gz	DAZLA_XENLA Deleted in azoospermia-like-A OS=Xenopus laevis OX=8355 GN=dazl-a PE=1 SV=1
7	AFDB:Q9YGW7	0.163	0.394	1.508E-9	229	0.125	0.306	Q9YGW7.pdb.gz	DAZL_DANRE Deleted in azoospermia-like OS=Danio rerio OX=7955 GN=dazl PE=1 SV=1
8	AFDB:Q8N9W6	0.167	0.319	3.560E-7	283	0.120	0.237	Q8N9W6.pdb.gz	BOLL_HUMAN Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL PE=1 SV=2
9	AFDB:Q24207	0.158	0.366	2.522E-6	228	0.102	0.250	Q24207.pdb.gz	BOULE_DROME Protein boule OS=Drosophila melanogaster OX=7227 GN=bol PE=1 SV=1
10	AFDB:A0A2R8QTX4	0.136	0.208	4.866E-5	360	0.052	0.081	A0A2R8QTX4.pdb.gz	A0A2R8QTX4_DANRE ELAV-like protein OS=Danio rerio OX=7955 GN=fb72d01 PE=1 SV=1
11	PDB:7dvqY	0.136	0.507	9.020E-4	140	0.034	0.136	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:5yzg1	0.128	0.285	2.947E-3	243	0.027	0.062	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:6qx91K	0.129	0.348	3.084E-3	201	0.027	0.075	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:6g90B	0.127	0.348	3.536E-3	193	0.038	0.109	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
15	PDB:6y53o	0.128	0.422	3.536E-3	160	0.043	0.150	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:7ohxo	0.133	0.579	3.700E-3	112	0.039	0.196	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
17	PDB:7oqcF	0.134	0.269	4.053E-3	267	0.052	0.109	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
18	PDB:6gd1A	0.128	0.355	5.327E-3	190	0.036	0.105	6gd1A.pdb.gz
19	PDB:6c0fo	0.126	0.466	5.575E-3	133	0.045	0.188	6c0fo.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
20	PDB:5xjcw	0.137	0.710	6.689E-3	91	0.036	0.220	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13117	0.0	1085	558	1.000	1.000	DAZ2_HUMAN Deleted in azoospermia protein 2 OS=Homo sapiens OX=9606 GN=DAZ2 PE=1 SV=3
2	Q86SG3	0.0	737	579	0.674	0.649	DAZ4_HUMAN Deleted in azoospermia protein 4 OS=Homo sapiens OX=9606 GN=DAZ4 PE=1 SV=2
3	Q9NQZ3	0.0	740	744	0.674	0.505	DAZ1_HUMAN Deleted in azoospermia protein 1 OS=Homo sapiens OX=9606 GN=DAZ1 PE=1 SV=2
4	Q9NR90	0.0	535	486	0.502	0.576	DAZ3_HUMAN Deleted in azoospermia protein 3 OS=Homo sapiens OX=9606 GN=DAZ3 PE=1 SV=1
5	Q92904	1.79e-97	300	295	0.290	0.549	DAZL_HUMAN Deleted in azoospermia-like OS=Homo sapiens OX=9606 GN=DAZL PE=1 SV=1
6	Q64368	2.12e-85	269	298	0.272	0.510	DAZL_MOUSE Deleted in azoospermia-like OS=Mus musculus OX=10090 GN=Dazl PE=1 SV=1
7	O57437	1.19e-54	188	286	0.179	0.350	DAZLA_XENLA Deleted in azoospermia-like-A OS=Xenopus laevis OX=8355 GN=dazl-a PE=1 SV=1
8	Q76CY5	2.77e-53	184	286	0.172	0.336	DAZL_XENTR Deleted in azoospermia-like OS=Xenopus tropicalis OX=8364 GN=dazl PE=2 SV=1
9	Q9YGW7	2.47e-34	131	229	0.111	0.271	DAZL_DANRE Deleted in azoospermia-like OS=Danio rerio OX=7955 GN=dazl PE=1 SV=1
10	Q8N9W6	4.52e-24	104	283	0.081	0.159	BOLL_HUMAN Protein boule-like OS=Homo sapiens OX=9606 GN=BOLL PE=1 SV=2
11	Q24207	7.73e-18	85.1	228	0.066	0.162	BOULE_DROME Protein boule OS=Drosophila melanogaster OX=7227 GN=bol PE=1 SV=1
12	Q20870	1.30e-15	82.0	499	0.061	0.068	DAZ1_CAEEL DAZ protein 1 OS=Caenorhabditis elegans OX=6239 GN=daz-1 PE=2 SV=3
13	Q62029	2.36e-09	62.4	628	0.061	0.054	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
14	Q6NYB0	5.62e-08	57.0	305	0.052	0.095	Q6NYB0_DANRE Zgc:77366 OS=Danio rerio OX=7955 GN=zgc:77366 PE=2 SV=1
15	O43251	6.28e-08	57.4	390	0.066	0.095	RFOX2_HUMAN RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3
16	A0A087WTT1	6.43e-08	57.8	588	0.048	0.046	A0A087WTT1_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
17	F1QS28	6.61e-08	56.6	305	0.052	0.095	F1QS28_DANRE Heterogeneous nuclear ribonucleoprotein A0 OS=Danio rerio OX=7955 GN=fc01g05 PE=1 SV=1
18	E7ERJ7	7.19e-08	57.8	604	0.048	0.045	E7ERJ7_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=1
19	P11940	9.59e-08	57.4	636	0.048	0.042	PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
20	P61286	9.59e-08	57.4	636	0.048	0.042	PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus OX=9913 GN=PABPC1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18872 Daz	1.8e-184	608.0	Daz repeat
2	PF00076 RRM_1	1.1e-07	42.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	5.7	18.4	RNA recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000055095

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000060395	0.683	Pan troglodytes chromodomain protein, Y-linked, 1 (CDY1), mRNA
2	9598.ENSPTRP00000029617	0.671	DND microRNA-mediated repression inhibitor 1
3	9598.ENSPTRP00000048426	0.663	Uncharacterized protein
4	9598.ENSPTRP00000042413	0.640	DEAD-box helicase 4
5	9598.ENSPTRP00000038771	0.638	ATP-dependent RNA helicase DDX3Y
6	9598.ENSPTRP00000018295	0.626	Pan troglodytes DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 (DDX49), mRNA
7	9598.ENSPTRP00000023243	0.614	Polyadenylate-binding protein
8	9598.ENSPTRP00000011043	0.612	RNA binding motif protein 25
9	9598.ENSPTRP00000028637	0.591	Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'- [...]
10	9598.ENSPTRP00000009525	0.590	RNA helicase
11	9598.ENSPTRP00000020091	0.588	Pumilio homolog 2
12	9598.ENSPTRP00000021121	0.588	Uncharacterized protein
13	9598.ENSPTRP00000029337	0.585	Uncharacterized protein
14	9598.ENSPTRP00000000792	0.578	Pumilio homolog 1
15	9598.ENSPTRP00000008454	0.556	DAZ associated protein 2
16	9598.ENSPTRP00000014825	0.540	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon (By similarity)
17	9598.ENSPTRP00000027042	0.540	Pan troglodytes eukaryotic translation initiation factor 4A2 (EIF4A2), mRNA
18	9598.ENSPTRP00000047824	0.531	Uncharacterized protein
19	9598.ENSPTRP00000059150	0.531	Uncharacterized protein
20	9598.ENSPTRP00000024409	0.526	Small nuclear ribonucleoprotein D3 polypeptide 18kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.762	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019953	0.973	sexual reproduction
GO:0022414	0.967	reproductive process
GO:0050789	0.602	regulation of biological process
GO:0009566	0.583	fertilization
GO:0019222	0.548	regulation of metabolic process
GO:0060255	0.543	regulation of macromolecule metabolic process
GO:0009987	0.532	cellular process
GO:0050794	0.529	regulation of cellular process
GO:0007338	0.498	single fertilization
GO:0010468	0.465	regulation of gene expression
GO:0080090	0.442	regulation of primary metabolic process
GO:0051171	0.442	regulation of nitrogen compound metabolic process
GO:0031323	0.442	regulation of cellular metabolic process
GO:0010556	0.331	regulation of macromolecule biosynthetic process
GO:0031326	0.331	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005737	0.902	cytoplasm
GO:0043227	0.333	membrane-bounded organelle
GO:0043229	0.332	intracellular organelle
GO:0005634	0.310	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]