StarFunc result for job id Q13118

User Input

>input (480 residues)
MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYV
ENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFK
SLSDTAKPHIAAPFKEEEKSPVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNY
QNNSFRRRTHLNVEAARKNIPCAAVSPNRSKCERNTVADVDEKASAALYDFSVPSSETVI
CRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLPANNPVVTTVVPSTPPSQPPA
VCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGFSPSAAKVTPQ
IDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR
RTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13118	1.000	1.000	7.710E-73	480	1.000	1.000	Q13118.pdb.gz	KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens OX=9606 GN=KLF10 PE=1 SV=1
2	AFDB:O08876	0.475	0.475	2.349E-57	480	0.848	0.848	O08876.pdb.gz	KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus OX=10116 GN=Klf10 PE=2 SV=1
3	AFDB:O14901	0.237	0.223	1.754E-20	512	0.375	0.352	O14901.pdb.gz	KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens OX=9606 GN=KLF11 PE=1 SV=2
4	AFDB:Q8CFA7	0.187	0.260	3.893E-13	341	0.188	0.264	Q8CFA7.pdb.gz	KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus OX=10090 GN=Klf17 PE=1 SV=2
5	AFDB:E9QG09	0.195	0.217	1.430E-12	429	0.231	0.259	E9QG09.pdb.gz	E9QG09_DANRE Krueppel-like factor 5 OS=Danio rerio OX=7955 GN=pibf1 PE=4 SV=1
6	AFDB:P08152	0.169	0.172	1.763E-10	470	0.210	0.215	P08152.pdb.gz	EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus OX=10090 GN=Egr2 PE=1 SV=3
7	AFDB:Q09838	0.203	0.146	1.570E-8	681	0.181	0.128	Q09838.pdb.gz	PRZ1_SCHPO Transcriptional regulator prz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prz1 PE=1 SV=1
8	AFDB:Q8K1M4	0.182	0.113	1.908E-8	789	0.192	0.117	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
9	AFDB:Q02086	0.188	0.148	2.320E-8	613	0.229	0.179	Q02086.pdb.gz	SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens OX=9606 GN=SP2 PE=1 SV=3
10	AFDB:Q5B154	0.168	0.114	9.095E-8	730	0.212	0.140	Q5B154.pdb.gz	Q5B154_EMENI C2H2-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05726 PE=4 SV=1
11	PDB:5c8dE	0.045	0.068	2.600	280	0.023	0.039	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
12	PDB:7pubDS	0.061	0.098	6.900	243	0.042	0.082	7pubDS.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08876	0.0	809	480	0.848	0.848	KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus OX=10116 GN=Klf10 PE=2 SV=1
2	O89091	0.0	820	479	0.854	0.856	KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus OX=10090 GN=Klf10 PE=1 SV=1
3	Q13118	0.0	983	480	1.000	1.000	KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens OX=9606 GN=KLF10 PE=1 SV=1
4	Q8K1S5	7.04e-90	285	502	0.412	0.394	KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus OX=10090 GN=Klf11 PE=2 SV=3
5	O14901	2.42e-89	283	512	0.419	0.393	KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens OX=9606 GN=KLF11 PE=1 SV=2
6	Q53QU8	2.42e-89	283	512	0.419	0.393	Q53QU8_HUMAN Uncharacterized protein TIEG2 OS=Homo sapiens OX=9606 GN=TIEG2 PE=2 SV=1
7	Q309C9	5.16e-86	275	501	0.412	0.395	Q309C9_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=2 SV=1
8	E9PTS6	5.39e-86	275	501	0.412	0.395	E9PTS6_RAT Kruppel-like factor 11 OS=Rattus norvegicus OX=10116 GN=Klf11 PE=4 SV=1
9	Q4R0P9	1.37e-40	152	428	0.127	0.143	Q4R0P9_DROME Cabut OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
10	Q95R58	1.43e-40	150	347	0.127	0.176	Q95R58_DROME SD05726p OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
11	Q8IPV7	1.47e-40	150	347	0.127	0.176	Q8IPV7_DROME Cabut, isoform B OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=1
12	Q9Y2Y9	1.61e-40	149	288	0.131	0.219	KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens OX=9606 GN=KLF13 PE=1 SV=1
13	Q9VPQ5	1.63e-40	152	428	0.127	0.143	Q9VPQ5_DROME Cabut, isoform A OS=Drosophila melanogaster OX=7227 GN=cbt PE=2 SV=2
14	Q9JJZ6	1.69e-40	149	289	0.131	0.218	KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus OX=10090 GN=Klf13 PE=1 SV=2
15	A8E7A9	8.48e-39	143	250	0.142	0.272	A8E7A9_DANRE Krueppel-like factor 16 OS=Danio rerio OX=7955 GN=wu:fi22b08 PE=4 SV=1
16	P08047	9.03e-39	152	785	0.129	0.079	SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=3
17	Q01713	9.74e-39	142	244	0.144	0.283	KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus OX=10116 GN=Klf9 PE=2 SV=1
18	O35739	1.22e-38	142	244	0.144	0.283	KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus OX=10090 GN=Klf9 PE=2 SV=1
19	O89090	1.30e-38	151	784	0.129	0.079	SP1_MOUSE Transcription factor Sp1 OS=Mus musculus OX=10090 GN=Sp1 PE=1 SV=2
20	Q01714	1.32e-38	151	786	0.129	0.079	SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus OX=10116 GN=Sp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13671 AAA_33	22	16.7	AAA domain
2	PF16159 FOXP-CC	48	15.9	FOXP coiled-coil domain
3	PF00096 zf-C2H2	9.6e-08	43.2	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	0.00033	32.2	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	25	16.6	C2H2-type zinc ribbon
6	PF13465 zf-H2C2_2	1.7e-06	39.4	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349156	0.831	E3 ubiquitin-protein ligase SIAH1
2	9606.ENSP00000378402	0.804	Paired amphipathic helix protein Sin3a
3	9606.ENSP00000356234	0.740	Lysine-specific demethylase 5B
4	9606.ENSP00000365380	0.717	Forkhead box protein P3
5	9606.ENSP00000362649	0.641	Histone deacetylase 1
6	9606.ENSP00000293414	0.626	Ankyrin repeat and SOCS box protein 16
7	9606.ENSP00000221930	0.559	Transforming growth factor beta-1
8	9606.ENSP00000263754	0.546	Histone acetyltransferase KAT2B
9	9606.ENSP00000329357	0.533	Transcription factor Sp1
10	9606.ENSP00000262158	0.527	Mothers against decapentaplegic homolog 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0080090	0.988	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0009987	0.986	cellular process
GO:0010468	0.986	regulation of gene expression
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0006355	0.984	regulation of DNA-templated transcription
GO:0048518	0.982	positive regulation of biological process
GO:0048519	0.980	negative regulation of biological process
GO:0048522	0.970	positive regulation of cellular process
GO:0048523	0.965	negative regulation of cellular process
GO:0009892	0.951	negative regulation of metabolic process
GO:0009893	0.943	positive regulation of metabolic process
GO:0010605	0.942	negative regulation of macromolecule metabolic process
GO:0010604	0.924	positive regulation of macromolecule metabolic process
GO:0031324	0.915	negative regulation of cellular metabolic process
GO:0051172	0.909	negative regulation of nitrogen compound metabolic process
GO:0031325	0.906	positive regulation of cellular metabolic process
GO:0045934	0.894	negative regulation of nucleobase-containing compound metabolic process
GO:0009891	0.886	positive regulation of biosynthetic process
GO:0010558	0.882	negative regulation of macromolecule biosynthetic process
GO:0031327	0.882	negative regulation of cellular biosynthetic process
GO:0051253	0.882	negative regulation of RNA metabolic process
GO:0010557	0.872	positive regulation of macromolecule biosynthetic process
GO:0051173	0.871	positive regulation of nitrogen compound metabolic process
GO:1903507	0.848	negative regulation of nucleic acid-templated transcription
GO:0045944	0.839	positive regulation of transcription by RNA polymerase II
GO:0045892	0.838	negative regulation of DNA-templated transcription
GO:0000122	0.785	negative regulation of transcription by RNA polymerase II
GO:0042127	0.738	regulation of cell population proliferation
GO:0007154	0.692	cell communication
GO:0023052	0.680	signaling
GO:0050896	0.613	response to stimulus
GO:0051716	0.375	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.655	nuclear lumen
GO:0005737	0.586	cytoplasm
GO:0005654	0.560	nucleoplasm
GO:0032991	0.378	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]