StarFunc result for job id Q13127

User Input

>input (1097 residues)
MATQVMGQSSGGGGLFTSSGNIGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNG
SCCDYLVGEERQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVE
PQPVFEASGAPDIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRV
HSAKKFFVEESAEKQAKARESGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTR
AGDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCGKCNYFSDRKNNYVQHVRTHTG
ERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRHARQVHNGPKP
LNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTM
DVSKVKLKKTKKREADLPDNITNEKTEIEQTKIKGDVAGKKNEKSVKAEKRDVSKEKKPS
NNVSVIQVTTRTRKSVTEVKEMDVHTGSNSEKFSKTKKSKRKLEVDSHSLHGPVNDEESS
TKKKKKVESKSKNNSQEVPKGDSKVEENKKQNTCMKKSTKKKTLKNKSSKKSSKPPQKEP
VEKGSAQMDPPQMGPAPTEAVQKGPVQVEPPPPMEHAQMEGAQIRPAPDEPVQMEVVQEG
PAQKELLPPVEPAQMVGAQIVLAHMELPPPMETAQTEVAQMGPAPMEPAQMEVAQVESAP
MQVVQKEPVQMELSPPMEVVQKEPVQIELSPPMEVVQKEPVKIELSPPIEVVQKEPVQME
LSPPMGVVQKEPAQREPPPPREPPLHMEPISKKPPLRKDKKEKSNMQSERARKEQVLIEV
GLVPVKDSWLLKESVSTEDLSPPSPPLPKENLREEASGDQKLLNTGEGNKEAPLQKVGAE
EADESLPGLAANINESTHISSSGQNLNTPEGETLNGKHQTDSIVCEMKMDTDQNTRENLT
GINSTVEEPVSPMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLS
DNMSEGSDDSGLHGARPVPQESSRKNAKEALAVKAAKGDFVCIFCDRSFRKGKDYSKHLN
RHLVNVYYLEEAAQGQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13127	1.000	1.000	0.000	1097	1.000	1.000	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
2	AFDB:O54963	0.286	0.293	1.757E-102	1069	0.661	0.678	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
3	AFDB:Q8VIG1	0.307	0.311	1.854E-99	1082	0.643	0.652	Q8VIG1.pdb.gz	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
4	AFDB:P08151	0.086	0.085	8.927E-15	1106	0.163	0.162	P08151.pdb.gz	GLI1_HUMAN Zinc finger protein GLI1 OS=Homo sapiens OX=9606 GN=GLI1 PE=1 SV=1
5	AFDB:F1QH64	0.085	0.077	1.802E-14	1225	0.172	0.154	F1QH64.pdb.gz
6	AFDB:A0A2R8QMX9	0.095	0.074	2.041E-13	1443	0.167	0.127	A0A2R8QMX9.pdb.gz
7	AFDB:Q9HAZ2	0.126	0.111	1.141E-11	1276	0.179	0.154	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
8	AFDB:A2A935	0.135	0.117	1.292E-10	1275	0.175	0.151	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
9	AFDB:Q92618	0.070	0.068	2.021E-10	1163	0.157	0.148	Q92618.pdb.gz	ZN516_HUMAN Zinc finger protein 516 OS=Homo sapiens OX=9606 GN=ZNF516 PE=1 SV=1
10	AFDB:Q7TSH3	0.076	0.073	2.964E-10	1157	0.153	0.145	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
11	PDB:3w5kB	0.051	0.255	3.676E-4	110	0.026	0.264	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6ydhA	0.026	0.180	3.414E-1	62	0.014	0.242	6ydhA.pdb.gz
13	PDB:7uhyC	0.027	0.044	1.078	578	0.015	0.028	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:7qcdD	0.039	0.086	1.305	326	0.019	0.064	7qcdD.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:6hivBe	0.025	0.140	1.685	101	0.008	0.089	6hivBe.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
16	PDB:7pfoB	0.030	0.037	1.685	759	0.015	0.021	7pfoB.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
17	PDB:6ff79	0.032	0.069	2.176	432	0.019	0.049	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7oqyY	0.018	0.156	2.472	92	0.015	0.185	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
19	PDB:4kblA	0.034	0.073	3.402	395	0.028	0.078	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
20	PDB:7uhyA	0.034	0.044	3.402	771	0.015	0.022	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PQA1	0.0	2087	1069	0.937	0.962	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
2	O54963	0.0	1246	1069	0.645	0.662	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
3	Q13127	0.0	2259	1097	1.000	1.000	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
4	Q8VIG1	0.0	1186	1082	0.644	0.652	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
5	Q2EI20	1.05e-149	471	855	0.215	0.276	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
6	Q8N9F8	1.34e-31	133	522	0.077	0.163	ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens OX=9606 GN=ZNF454 PE=2 SV=2
7	P10073	1.52e-31	132	491	0.067	0.149	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
8	Q9UJL9	5.43e-29	125	534	0.076	0.155	ZF69B_HUMAN Zinc finger protein 69 homolog B OS=Homo sapiens OX=9606 GN=ZFP69B PE=1 SV=2
9	Q9NTW7	8.05e-29	125	645	0.075	0.127	ZF64B_HUMAN Zinc finger protein 64 OS=Homo sapiens OX=9606 GN=ZFP64 PE=1 SV=3
10	Q7L3S4	1.84e-28	119	317	0.069	0.240	ZN771_HUMAN Zinc finger protein 771 OS=Homo sapiens OX=9606 GN=ZNF771 PE=1 SV=1
11	Q86TJ5	2.06e-28	123	538	0.065	0.132	ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens OX=9606 GN=ZNF554 PE=1 SV=1
12	Q9EQB9	2.15e-28	125	759	0.069	0.100	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
13	P28698	2.19e-28	125	734	0.073	0.109	MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens OX=9606 GN=MZF1 PE=1 SV=3
14	Q99KE8	3.71e-28	124	643	0.075	0.128	ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus OX=10090 GN=Zfp64 PE=1 SV=1
15	M9PD94	8.49e-28	124	907	0.077	0.093	M9PD94_DROME Crooked legs, isoform F OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
16	P10075	1.29e-27	118	376	0.059	0.173	GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens OX=9606 GN=GLI4 PE=1 SV=2
17	Q9UEG4	1.93e-27	122	869	0.070	0.089	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
18	M9PCY3	2.92e-27	122	878	0.073	0.091	M9PCY3_DROME Crooked legs, isoform G OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
19	Q6PD29	3.34e-27	119	541	0.048	0.098	ZN513_MOUSE Zinc finger protein 513 OS=Mus musculus OX=10090 GN=Znf513 PE=1 SV=2
20	A2APF3	3.58e-27	120	636	0.057	0.099	CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus OX=10090 GN=Ctcfl PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	1.2e-09	49.2	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	2.7e-06	38.7	C2H2-type zinc finger
3	PF13465 zf-H2C2_2	1e-27	106.5	Zinc-finger double domain
4	PF13909 zf-H2C2_5	5.2e-20	82.2	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311816

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262241	0.999	REST corepressor 1
2	9606.ENSP00000362649	0.995	Histone deacetylase 1
3	9606.ENSP00000347184	0.992	Huntingtin
4	9606.ENSP00000378402	0.991	Paired amphipathic helix protein Sin3a
5	9606.ENSP00000273062	0.957	Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1
6	9606.ENSP00000383042	0.946	Lysine-specific histone demethylase 1A
7	9606.ENSP00000369131	0.935	Paired amphipathic helix protein Sin3b
8	9606.ENSP00000289316	0.933	Histone H2B type 1-D
9	9606.ENSP00000476136	0.930	Histone H2B type 1-J
10	9606.ENSP00000479169	0.929	Histone H2B type 1-H
11	9606.ENSP00000483903	0.929	Histone H2B type 1-N
12	9606.ENSP00000367022	0.927	Histone H2A type 1-C
13	9606.ENSP00000328484	0.926	Histone H2A type 1-J
14	9606.ENSP00000358151	0.925	Histone H2B type 2-E
15	9606.ENSP00000430432	0.925	Histone deacetylase 2
16	9606.ENSP00000332194	0.920	Histone H2A type 2-C
17	9606.ENSP00000249330	0.918	Neurosecretory protein VGF
18	9606.ENSP00000359206	0.914	F-box/WD repeat-containing protein 1A
19	9606.ENSP00000264606	0.908	Histone deacetylase 4
20	9606.ENSP00000274764	0.907	Histone H2B type 1-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.988	regulation of metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0045892	0.981	negative regulation of DNA-templated transcription
GO:0048518	0.932	positive regulation of biological process
GO:0050896	0.930	response to stimulus
GO:0048522	0.902	positive regulation of cellular process
GO:0006357	0.885	regulation of transcription by RNA polymerase II
GO:0000122	0.780	negative regulation of transcription by RNA polymerase II
GO:0009893	0.728	positive regulation of metabolic process
GO:0010604	0.711	positive regulation of macromolecule metabolic process
GO:0051173	0.664	positive regulation of nitrogen compound metabolic process
GO:0031325	0.659	positive regulation of cellular metabolic process
GO:0009891	0.628	positive regulation of biosynthetic process
GO:0031328	0.604	positive regulation of cellular biosynthetic process
GO:0045935	0.579	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.578	positive regulation of macromolecule biosynthetic process
GO:0051254	0.559	positive regulation of RNA metabolic process
GO:0045893	0.543	positive regulation of DNA-templated transcription
GO:0051716	0.453	cellular response to stimulus
GO:0071840	0.397	cellular component organization or biogenesis
GO:0048583	0.387	regulation of response to stimulus
GO:0032501	0.376	multicellular organismal process
GO:0032502	0.355	developmental process
GO:0065009	0.346	regulation of molecular function
GO:0016043	0.335	cellular component organization
GO:0048856	0.316	anatomical structure development
GO:0006950	0.302	response to stress
GO:0023051	0.302	regulation of signaling
GO:0010646	0.302	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0005829	0.991	cytosol
GO:0005667	0.951	transcription regulator complex
GO:0017053	0.483	transcription repressor complex
GO:0043232	0.371	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]