StarFunc result for job id Q13129

User Input

>input (1914 residues)
MADGKGDAAAVAGAGAEAPAVAGAGDGVETESMVRGHRPVSPAPGASGLRPCLWQLETEL
REQEVSEVSSLNYCRSFCQTLLQYASNKNASEHIVYLLEVYRLAIQSFASARPYLTTECE
DVLLVLGRLVLSCFELLLSVSESELPCEVWLPFLQSLQESHDALLEFGNNNLQILVHVTK
EGVWKNPVLLKILSQQPVETEEVNKLIAQEGPSFLQMRIKHLLKSNCIPQATALSKLCAE
SKEISNVSSFQQAYITCLCSMLPNEDAIKEIAKVDCKEVLDIICNLESEGQDNTAFVLCT
TYLTQQLQTASVYCSWELTLFWSKLQRRIDPSLDTFLERCRQFGVIAKTQQHLFCLIRVI
QTEAQDAGLGVSILLCVRALQLRSSEDEEMKASVCKTIACLLPEDLEVRRACQLTEFLIE
PSLDGFNMLEELYLQPDQKFDEENAPVPNSLRCELLLALKAHWPFDPEFWDWKTLKRHCH
QLLGQEASDSDDDLSGYEMSINDTDVLESFLSDYDEGKEDKQYRRRDLTDQHKEKRDKKP
IGSSERYQRWLQYKFFCLLCKRECIEARILHHSKMHMEDGIYTCPVCIKKFKRKEMFVPH
VMEHVKMPPSRRDRSKKKLLLKGSQKGICPKSPSAIPEQNHSLNDQAKGESHEYVTFSKL
EDCHLQDRDLYPCPGTDCSRVFKQFKYLSVHLKAEHQNNDENAKHYLDMKNRREKCTYCR
RHFMSAFHLREHEQVHCGPQPYMCVSIDCYARFGSVNELLNHKQKHDDLRYKCELNGCNI
VFSDLGQLYHHEAQHFRDASYTCNFLGCKKFYYSKIEYQNHLSMHNVENSNGDIKKSVKL
EESATGEKQDCINQPHLLNQTDKSHLPEDLFCAESANSQIDTETAENLKENSDSNSSDQL
SHSSSASMNEELIDTLDHSETMQDVLLSNEKVFGPSSLKEKCSSMAVCFDGTKFTCGFDG
CGSTYKNARGMQKHLRKVHPYHFKPKKIKTKDLFPSLGNEHNQTTEKLDAEPKPCSDTNS
DSPDEGLDHNIHIKCKREHQGYSSESSICASKRPCTEDTMLELLLRLKHLSLKNSITHGS
FSGSLQGYPSSGAKSLQSVSSISDLNFQNQDENMPSQYLAQLAAKPFFCELQGCKYEFVT
REALLMHYLKKHNYSKEKVLQLTMFQHRYSPFQCHICQRSFTRKTHLRIHYKNKHQIGSD
RATHKLLDNEKCDHEGPCSVDRLKGDCSAELGGDPSSNSEKPHCHPKKDECSSETDLESS
CEETESKTSDISSPIGSHREEQEGREGRGSRRTVAKGNLCYILNKYHKPFHCIHKTCNSS
FTNLKGLIRHYRTVHQYNKEQLCLEKDKARTKRELVKCKKIFACKYKECNKRFLCSKALA
KHCSDSHNLDHIEEPKVLSEAGSAARFSCNQPQCPAVFYTFNKLKHHLMEQHNIEGEIHS
DYEIHCDLNGCGQIFTHRSNYSQHVYYRHKDYYDDLFRSQKVANERLLRSEKVCQTADTQ
GHEHQTTRRSFNAKSKKCGLIKEKKAPISFKTRAEALHMCVEHSEHTQYPCMVQGCLSVV
KLESSIVRHYKRTHQMSSAYLEQQMENLVVCVKYGTKIKEEPPSEADPCIKKEENRSCES
ERTEHSHSPGDSSAPIQNTDCCHSSERDGGQKGCIESSSVFDADTLLYRGTLKCNHSSKT
TSLEQCNIVQPPPPCKIENSIPNPNGTESGTYFTSFQLPLPRIKESETRQHSSGQENTVK
NPTHVPKENFRKHSQPRSFDLKTYKPMGFESSFLKFIQESEEKEDDFDDWEPSEHLTLSN
SSQSSNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENL
RVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A7F4	0.299	0.298	0.000	1918	0.886	0.884	A2A7F4.pdb.gz	A2A7F4_MOUSE Rearranged L-myc fusion sequence OS=Mus musculus OX=10090 GN=Rlf PE=1 SV=1
2	AFDB:Q13129	1.000	1.000	0.000	1914	1.000	1.000	Q13129.pdb.gz	RLF_HUMAN Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2
3	AFDB:Q9VXG1	0.045	0.045	2.782E-11	1959	0.106	0.104	Q9VXG1.pdb.gz	HANG_DROME Zinc finger protein hangover OS=Drosophila melanogaster OX=7227 GN=hang PE=1 SV=4
4	AFDB:Q7TSH3	0.032	0.044	1.704E-8	1157	0.092	0.152	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
5	AFDB:F1QH64	0.040	0.052	8.965E-8	1225	0.093	0.145	F1QH64.pdb.gz
6	AFDB:F1QSH8	0.046	0.052	1.923E-7	1553	0.110	0.135	F1QSH8.pdb.gz
7	AFDB:F1QAC4	0.047	0.053	2.200E-7	1404	0.111	0.151	F1QAC4.pdb.gz	F1QAC4_DANRE GLI family zinc finger 1 OS=Danio rerio OX=7955 GN=gli1 PE=3 SV=1
8	AFDB:Q6PR54	0.086	0.074	2.200E-7	2419	0.146	0.115	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
9	AFDB:O95996	0.070	0.065	4.934E-7	2303	0.141	0.117	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
10	AFDB:Q9IA31	0.051	0.055	6.175E-7	1544	0.104	0.130	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
11	PDB:2y4uA	0.070	0.185	7.055E-4	424	0.031	0.142	2y4uA.pdb.gz
12	PDB:7ntfA	0.066	0.114	1.156E-3	918	0.021	0.045	7ntfA.pdb.gz
13	PDB:4horA	0.060	0.166	1.582E-3	482	0.029	0.116	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
14	PDB:7dhgC	0.064	0.207	2.370E-3	470	0.032	0.130	7dhgC.pdb.gz
15	PDB:7tdzC	0.055	0.113	4.061E-3	653	0.034	0.100	7tdzC.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
16	PDB:6xt9D	0.074	0.228	5.082E-3	396	0.025	0.121	6xt9D.pdb.gz
17	PDB:8a3tJ	0.060	0.155	6.653E-3	509	0.027	0.102	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	PDB:4kvmB	0.053	0.104	8.326E-3	722	0.033	0.089	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
19	PDB:7qe7Y	0.062	0.179	8.708E-3	502	0.029	0.110	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	PDB:6tedQ	0.070	0.105	1.192E-2	890	0.034	0.074	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A7F4	0.0	3335	1918	0.875	0.873	A2A7F4_MOUSE Rearranged L-myc fusion sequence OS=Mus musculus OX=10090 GN=Rlf PE=1 SV=1
2	D3ZXZ1	0.0	711	2706	0.200	0.141	D3ZXZ1_RAT Zinc finger protein 292 OS=Rattus norvegicus OX=10116 GN=Zfp292 PE=1 SV=1
3	E9Q532	0.0	3153	1808	0.824	0.872	E9Q532_MOUSE Rearranged L-myc fusion sequence OS=Mus musculus OX=10090 GN=Rlf PE=1 SV=1
4	Q13129	0.0	3977	1914	1.000	1.000	RLF_HUMAN Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2
5	Q3TR19	0.0	691	344	0.172	0.959	Q3TR19_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
6	Q3V1H6	0.0	1412	764	0.362	0.906	Q3V1H6_MOUSE C2H2-type domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
7	Q59GL0	0.0	3324	1608	0.835	0.994	Q59GL0_HUMAN Rearranged L-myc fusion sequence variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q922U7	0.0	1141	685	0.299	0.836	Q922U7_MOUSE Rlf protein (Fragment) OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
9	Q3TAD2	8.90e-179	544	299	0.135	0.866	Q3TAD2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
10	Q8BVB9	1.97e-151	469	282	0.122	0.826	Q8BVB9_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Rlf PE=2 SV=1
11	A0A8I6G798	1.21e-149	517	2468	0.142	0.110	A0A8I6G798_RAT Zinc finger protein 292 OS=Rattus norvegicus OX=10116 GN=Zfp292 PE=4 SV=1
12	Q6PWU7	5.13e-12	73.2	525	0.023	0.084	Q6PWU7_DANRE Zic family member 6 OS=Danio rerio OX=7955 GN=zic6 PE=2 SV=1
13	Q8N9L1	5.35e-12	71.6	334	0.022	0.129	ZIC4_HUMAN Zinc finger protein ZIC 4 OS=Homo sapiens OX=9606 GN=ZIC4 PE=2 SV=3
14	A6NJL1	6.65e-12	72.8	495	0.026	0.099	ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ZSCAN5B PE=1 SV=1
15	Q9EQJ4	1.20e-11	72.0	579	0.034	0.112	ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus OX=10116 GN=Znf384 PE=1 SV=1
16	Q61467	1.52e-11	70.5	341	0.024	0.132	ZIC4_MOUSE Zinc finger protein ZIC 4 OS=Mus musculus OX=10090 GN=Zic4 PE=1 SV=2
17	Q8TF68	2.15e-11	71.2	577	0.034	0.113	ZN384_HUMAN Zinc finger protein 384 OS=Homo sapiens OX=9606 GN=ZNF384 PE=1 SV=2
18	Q08BV0	5.59e-11	69.7	466	0.022	0.090	Q08BV0_DANRE Zic family member4 OS=Danio rerio OX=7955 GN=wu:fj36d02 PE=2 SV=1
19	A0JC51	5.73e-11	69.7	530	0.030	0.108	ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis OX=8355 GN=zic4 PE=2 SV=1
20	Q9P2J8	5.75e-11	70.5	865	0.040	0.088	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16159 FOXP-CC	2.2e+02	13.7	FOXP coiled-coil domain
2	PF00096 zf-C2H2	1.3e-09	49.1	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	0.011	27.5	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	37	16.2	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484135	0.768	Colorectal cancer associated 2
2	9606.ENSP00000380494	0.764	Protein L-Myc
3	9606.ENSP00000398064	0.747	HIG1 domain family member 1A, mitochondrial
4	9606.ENSP00000414721	0.743	WW domain binding protein 1 like
5	9606.ENSP00000264157	0.736	Cyclin-T2
6	9606.ENSP00000386657	0.633	Protein FAM183BP
7	9606.ENSP00000356426	0.625	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
8	9606.ENSP00000326063	0.617	Transmembrane protein 39A
9	9606.ENSP00000264245	0.613	Rho GTPase-activating protein 31
10	9606.ENSP00000334415	0.604	Protein FAM183A
11	9606.ENSP00000290943	0.527	Ankyrin repeat domain-containing protein 18B
12	9606.ENSP00000209875	0.519	Chromobox protein homolog 5
13	9606.ENSP00000362759	0.511	Adhesion G protein-coupled receptor B2
14	9606.ENSP00000473036	0.505	Paraneoplastic antigen-like protein 8B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.926	nucleic acid binding
GO:0003677	0.835	DNA binding
GO:0043565	0.378	sequence-specific DNA binding
GO:0140110	0.365	transcription regulator activity
GO:0003700	0.346	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.989	regulation of metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0051052	0.979	regulation of DNA metabolic process
GO:0036211	0.978	protein modification process
GO:0051568	0.973	histone H3-K4 methylation
GO:0044030	0.932	regulation of DNA methylation
GO:0048518	0.389	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.969	nucleus
GO:0005576	0.769	extracellular region
GO:0031982	0.742	vesicle
GO:0005737	0.675	cytoplasm
GO:0016020	0.614	membrane
GO:0070013	0.566	intracellular organelle lumen
GO:0005654	0.538	nucleoplasm
GO:0070062	0.426	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]