StarFunc result for job id Q13131

User Input

>input (559 residues)
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:W5PHS8	0.895	0.872	4.525E-91	574	0.987	0.962	W5PHS8.pdb.gz	W5PHS8_SHEEP Acetyl-CoA carboxylase kinase OS=Ovis aries OX=9940 GN=PRKAA1 PE=3 SV=1
2	AFDB:A5WUM0	0.856	0.835	8.677E-84	573	0.860	0.839	A5WUM0.pdb.gz	A5WUM0_DANRE Acetyl-CoA carboxylase kinase OS=Danio rerio OX=7955 GN=cb116 PE=1 SV=1
3	AFDB:A0A060VX13	0.840	0.840	7.197E-83	559	0.846	0.846	A0A060VX13.pdb.gz	A0A060VX13_ONCMY Acetyl-CoA carboxylase kinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00072767001 PE=3 SV=1
4	AFDB:P54646	0.836	0.847	6.922E-77	552	0.751	0.761	P54646.pdb.gz	AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2
5	AFDB:A0A060YAF5	0.790	0.771	5.452E-76	573	0.798	0.778	A0A060YAF5.pdb.gz	A0A060YAF5_ONCMY Acetyl-CoA carboxylase kinase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00033152001 PE=3 SV=1
6	PDB:4rerA	0.792	0.960	8.391E-67	459	0.814	0.991	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
7	AFDB:O18645	0.807	0.776	4.024E-65	582	0.587	0.564	O18645.pdb.gz	O18645_DROME AMP-activated protein kinase alpha subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=1 SV=1
8	PDB:6b1uA	0.766	0.964	2.097E-64	442	0.662	0.837	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
9	AFDB:Q95ZQ4	0.785	0.704	8.449E-64	626	0.589	0.526	Q95ZQ4.pdb.gz	AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans OX=6239 GN=aak-2 PE=1 SV=2
10	PDB:7myjC	0.790	0.946	2.138E-63	465	0.676	0.813	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
11	PDB:4zhxA	0.711	0.968	1.121E-59	409	0.631	0.863	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
12	PDB:5ufuA	0.653	0.987	1.166E-57	369	0.657	0.995	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
13	PDB:4rewA	0.704	0.951	5.770E-57	411	0.728	0.990	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
14	AFDB:P45894	0.664	0.632	2.004E-53	589	0.445	0.423	P45894.pdb.gz	AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans OX=6239 GN=aak-1 PE=2 SV=2
15	AFDB:B9DFC1	0.631	0.687	1.480E-50	512	0.404	0.441	B9DFC1.pdb.gz	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
16	AFDB:P92958	0.629	0.686	2.017E-50	512	0.404	0.441	P92958.pdb.gz	KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1
17	PDB:4cztD	0.427	0.763	1.988E-24	302	0.224	0.414	4cztD.pdb.gz
18	PDB:5u6yA	0.424	0.513	1.341E-23	459	0.193	0.235	5u6yA.pdb.gz
19	PDB:4d28C	0.421	0.821	1.649E-23	279	0.208	0.416	4d28C.pdb.gz
20	PDB:6byrA	0.443	0.604	9.529E-23	405	0.165	0.227	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060VX13	0.0	984	559	0.848	0.848	A0A060VX13_ONCMY Acetyl-CoA carboxylase kinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00072767001 PE=3 SV=1
2	A0A060YAF5	0.0	911	573	0.789	0.770	A0A060YAF5_ONCMY Acetyl-CoA carboxylase kinase (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00033152001 PE=3 SV=1
3	A5WUM0	0.0	966	573	0.866	0.845	A5WUM0_DANRE Acetyl-CoA carboxylase kinase OS=Danio rerio OX=7955 GN=cb116 PE=1 SV=1
4	O18645	0.0	636	582	0.605	0.581	O18645_DROME AMP-activated protein kinase alpha subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=1 SV=1
5	P54645	0.0	1160	559	0.991	0.991	AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Prkaa1 PE=1 SV=2
6	P54646	0.0	873	552	0.751	0.761	AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens OX=9606 GN=PRKAA2 PE=1 SV=2
7	Q09137	0.0	869	552	0.748	0.757	AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Prkaa2 PE=1 SV=1
8	Q13131	0.0	1168	559	1.000	1.000	AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4
9	Q2LAI0	0.0	861	552	0.755	0.764	Q2LAI0_CHICK 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Gallus gallus OX=9031 GN=PRKAA2 PE=2 SV=1
10	Q2PUH1	0.0	1083	560	0.945	0.943	Q2PUH1_CHICK Acetyl-CoA carboxylase kinase OS=Gallus gallus OX=9031 GN=PRKAA1 PE=1 SV=1
11	Q5EG47	0.0	1157	559	0.987	0.987	AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus OX=10090 GN=Prkaa1 PE=1 SV=2
12	Q5U118	0.0	634	582	0.603	0.579	Q5U118_DROME LP06206p OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=2 SV=1
13	Q8BRK8	0.0	867	552	0.748	0.757	AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus OX=10090 GN=Prkaa2 PE=1 SV=3
14	Q95ZQ4	0.0	632	626	0.594	0.530	AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans OX=6239 GN=aak-2 PE=1 SV=2
15	W5PHS8	0.0	1153	574	0.993	0.967	W5PHS8_SHEEP Acetyl-CoA carboxylase kinase OS=Ovis aries OX=9940 GN=PRKAA1 PE=3 SV=1
16	W5PHS9	0.0	1162	559	0.993	0.993	W5PHS9_SHEEP Acetyl-CoA carboxylase kinase OS=Ovis aries OX=9940 GN=PRKAA1 PE=3 SV=1
17	P45894	1.10e-151	449	589	0.424	0.402	AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans OX=6239 GN=aak-1 PE=2 SV=2
18	Q38997	6.03e-149	439	512	0.408	0.445	KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana OX=3702 GN=KIN10 PE=1 SV=3
19	B9DFC1	8.26e-149	439	512	0.408	0.445	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
20	A0A060YH61	8.96e-148	428	291	0.367	0.704	A0A060YH61_ONCMY Protein kinase domain-containing protein (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008872001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.022	25.4	ABC1 atypical kinase-like domain
2	PF16579 AdenylateSensor	4.2e-10	51.5	Adenylate sensor of SNF1-like protein kinase
3	PF01636 APH	1.9e+02	13.3	Phosphotransferase enzyme family
4	PF06293 Kdo	34	15.3	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.1	23.5	Kinase-like
6	PF00069 Pkinase	7.2e-72	253.5	Protein kinase domain
7	PF07714 PK_Tyr_Ser-Thr	5.7e-39	145.5	Protein tyrosine and serine/threonine kinase
8	PF01163 RIO1	7.6	17.6	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020019

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000281	0.999	Protein kinase, AMP-activated, beta 1 non-catalytic subunit
2	61853.ENSNLEP00000021687	0.999	Protein kinase, AMP-activated, gamma 1 non-catalytic subunit
3	61853.ENSNLEP00000000188	0.998	Protein kinase, AMP-activated, beta 2 non-catalytic subunit
4	61853.ENSNLEP00000005558	0.990	Protein kinase, AMP-activated, gamma 2 non-catalytic subunit
5	61853.ENSNLEP00000010938	0.986	Protein kinase, AMP-activated, gamma 3 non-catalytic subunit
6	61853.ENSNLEP00000003141	0.979	acetyl-CoA carboxylase alpha
7	61853.ENSNLEP00000011129	0.973	Tuberous sclerosis 2
8	61853.ENSNLEP00000011677	0.972	Serine/threonine-protein kinase mTOR
9	61853.ENSNLEP00000017863	0.972	Protein kinase, AMP-activated, alpha 2 catalytic subunit
10	61853.ENSNLEP00000001682	0.969	Serine/threonine kinase 11
11	61853.ENSNLEP00000019542	0.967	Calcium/calmodulin-dependent protein kinase kinase 2, beta
12	61853.ENSNLEP00000019227	0.965	Regulatory associated protein of MTOR, complex 1
13	61853.ENSNLEP00000016255	0.952	Protein kinase, cAMP-dependent, catalytic, alpha
14	61853.ENSNLEP00000014239	0.946	Epithelial ion channel that plays an important role in the regulation of epithelial ion and water transport and fluid homeostasis. Mediates the transport of chloride ions across the cell membrane (By similarity). Channel activity is coupled to ATP hydrolysis. The ion channel is also permeable to HCO(3-)
15	61853.ENSNLEP00000015722	0.943	Tuberous sclerosis 1
16	61853.ENSNLEP00000020343	0.934	PPARG coactivator 1 alpha
17	61853.ENSNLEP00000012062	0.923	Belongs to the protein kinase superfamily.
18	61853.ENSNLEP00000016783	0.919	Calcium binding protein 39
19	61853.ENSNLEP00000005879	0.913	Glycogen [starch] synthase
20	61853.ENSNLEP00000024372	0.912	TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004679	1.000	AMP-activated protein kinase activity
GO:0097159	0.406	organic cyclic compound binding
GO:1901363	0.405	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.983	response to stimulus
GO:0050789	0.971	regulation of biological process
GO:0050794	0.962	regulation of cellular process
GO:0071704	0.960	organic substance metabolic process
GO:0044238	0.955	primary metabolic process
GO:0042221	0.951	response to chemical
GO:0051716	0.922	cellular response to stimulus
GO:0048518	0.877	positive regulation of biological process
GO:0019222	0.872	regulation of metabolic process
GO:0043170	0.870	macromolecule metabolic process
GO:0006807	0.864	nitrogen compound metabolic process
GO:0048522	0.856	positive regulation of cellular process
GO:1901564	0.849	organonitrogen compound metabolic process
GO:0060255	0.841	regulation of macromolecule metabolic process
GO:0080090	0.839	regulation of primary metabolic process
GO:0009893	0.839	positive regulation of metabolic process
GO:0051171	0.824	regulation of nitrogen compound metabolic process
GO:0036211	0.805	protein modification process
GO:0010604	0.765	positive regulation of macromolecule metabolic process
GO:1901701	0.760	cellular response to oxygen-containing compound
GO:0051173	0.759	positive regulation of nitrogen compound metabolic process
GO:0071310	0.751	cellular response to organic substance
GO:0044237	0.736	cellular metabolic process
GO:0071840	0.712	cellular component organization or biogenesis
GO:0065009	0.701	regulation of molecular function
GO:0016043	0.690	cellular component organization
GO:0051246	0.638	regulation of protein metabolic process
GO:0043067	0.538	regulation of programmed cell death
GO:0042981	0.528	regulation of apoptotic process
GO:0006796	0.496	phosphate-containing compound metabolic process
GO:0033993	0.435	response to lipid
GO:0051247	0.435	positive regulation of protein metabolic process
GO:0007154	0.419	cell communication
GO:0031323	0.407	regulation of cellular metabolic process
GO:0050790	0.355	regulation of catalytic activity
GO:0016310	0.323	phosphorylation
GO:0048519	0.322	negative regulation of biological process
GO:0048523	0.314	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:1902494	0.999	catalytic complex
GO:0005634	0.999	nucleus
GO:0016020	0.983	membrane
GO:0005829	0.960	cytosol
GO:1990234	0.933	transferase complex
GO:0140535	0.932	intracellular protein-containing complex
GO:0031588	0.921	nucleotide-activated protein kinase complex
GO:0042995	0.897	cell projection
GO:0120025	0.886	plasma membrane bounded cell projection
GO:0036477	0.834	somatodendritic compartment
GO:0043005	0.817	neuron projection
GO:0070013	0.813	intracellular organelle lumen
GO:0044297	0.810	cell body
GO:0031981	0.791	nuclear lumen
GO:0043025	0.767	neuronal cell body
GO:0005654	0.760	nucleoplasm
GO:0005886	0.753	plasma membrane
GO:0030424	0.746	axon
GO:0030425	0.622	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.11.11	1.000	cAMP-dependent protein kinase.

[back to server]