StarFunc result for job id Q13133

User Input

>input (447 residues)
MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEA
AEPTALLTRAEPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKG
FFRRSVIKGAHYICHSGGHCPMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLK
RQEEEQAHATSLPPRASSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPM
APDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLL
ETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLI
AISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV
HSEQVFALRLQDKKLPPLLSEIWDVHE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4DXU5	0.611	0.603	1.891E-56	453	0.971	0.958	B4DXU5.pdb.gz	B4DXU5_HUMAN Nuclear receptor subfamily 1 group H member 3 OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
2	AFDB:Q62685	0.796	0.800	1.105E-54	445	0.913	0.917	Q62685.pdb.gz	NR1H3_RAT Oxysterols receptor LXR-alpha OS=Rattus norvegicus OX=10116 GN=Nr1h3 PE=1 SV=1
3	AFDB:Q8JHU1	0.620	0.674	1.210E-45	409	0.698	0.763	Q8JHU1.pdb.gz	Q8JHU1_CHICK Liver X receptor OS=Gallus gallus OX=9031 GN=LXR PE=1 SV=1
4	AFDB:A0A060WYW4	0.554	0.537	5.944E-44	462	0.680	0.658	A0A060WYW4.pdb.gz	A0A060WYW4_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00014026001 PE=3 SV=1
5	AFDB:A0A0R4IVP0	0.556	0.564	2.479E-43	441	0.664	0.673	A0A0R4IVP0.pdb.gz	A0A0R4IVP0_DANRE Nuclear receptor subfamily 1, group H, member 3 OS=Danio rerio OX=7955 GN=im:7141239 PE=3 SV=1
6	AFDB:F1D8P7	0.541	0.525	1.218E-41	461	0.644	0.625	F1D8P7.pdb.gz	F1D8P7_HUMAN Liver X nuclear receptor beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=1
7	AFDB:O18473	0.672	0.530	8.194E-27	576	0.380	0.295	O18473.pdb.gz	ECR_HELVI Ecdysone receptor OS=Heliothis virescens OX=7102 GN=EcR PE=1 SV=1
8	AFDB:A0A2R8QR22	0.574	0.535	3.417E-26	483	0.385	0.356	A0A2R8QR22.pdb.gz
9	AFDB:P34021	0.559	0.312	4.026E-25	878	0.396	0.202	P34021.pdb.gz	ECR_DROME Ecdysone receptor OS=Drosophila melanogaster OX=7227 GN=EcR PE=1 SV=1
10	AFDB:Q60641	0.482	0.444	8.046E-25	488	0.338	0.309	Q60641.pdb.gz	NR1H4_MOUSE Bile acid receptor OS=Mus musculus OX=10090 GN=Nr1h4 PE=1 SV=3
11	PDB:3dzyA	0.442	0.629	5.039E-15	302	0.192	0.285	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.475	0.869	4.161E-13	238	0.168	0.315	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.409	0.719	1.507E-6	246	0.110	0.199	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.385	0.642	4.445E-6	259	0.110	0.189	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7kzqE	0.091	0.095	2.903E-2	419	0.083	0.088	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
16	PDB:4alyA	0.096	0.159	7.523E-2	211	0.065	0.137	4alyA.pdb.gz
17	PDB:7wq3R	0.109	0.147	2.035E-1	289	0.051	0.080	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
18	PDB:7qsnH	0.158	0.215	2.420E-1	291	0.067	0.103	7qsnH.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
19	PDB:7sqoR	0.114	0.162	2.527E-1	270	0.072	0.119	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.
20	PDB:7wv9R	0.125	0.169	2.527E-1	290	0.087	0.134	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A060VSG9	0.0	592	425	0.671	0.706	A0A060VSG9_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00064070001 PE=3 SV=1
2	A0A060WYW4	0.0	601	462	0.649	0.628	A0A060WYW4_ONCMY Oxysterols receptor LXR-alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00014026001 PE=3 SV=1
3	A0A0R4IVP0	0.0	607	441	0.647	0.655	A0A0R4IVP0_DANRE Nuclear receptor subfamily 1, group H, member 3 OS=Danio rerio OX=7955 GN=im:7141239 PE=3 SV=1
4	B4DXU5	0.0	889	453	0.966	0.954	B4DXU5_HUMAN Nuclear receptor subfamily 1 group H member 3 OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
5	B8Y3M1	0.0	601	462	0.685	0.662	B8Y3M1_ONCMY Liver X receptor OS=Oncorhynchus mykiss OX=8022 GN=LXR PE=2 SV=1
6	F1D8N1	0.0	924	447	1.000	1.000	F1D8N1_HUMAN Liver X nuclear receptor alpha variant 1 OS=Homo sapiens OX=9606 GN=NR1H3 PE=2 SV=1
7	F1D8P7	0.0	523	461	0.631	0.612	F1D8P7_HUMAN Liver X nuclear receptor beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=1
8	P55055	0.0	536	460	0.629	0.611	NR1H2_HUMAN Oxysterols receptor LXR-beta OS=Homo sapiens OX=9606 GN=NR1H2 PE=1 SV=2
9	Q13133	0.0	924	447	1.000	1.000	NR1H3_HUMAN Oxysterols receptor LXR-alpha OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=2
10	Q60644	0.0	532	446	0.620	0.621	NR1H2_MOUSE Oxysterols receptor LXR-beta OS=Mus musculus OX=10090 GN=Nr1h2 PE=1 SV=1
11	Q62685	0.0	841	445	0.913	0.917	NR1H3_RAT Oxysterols receptor LXR-alpha OS=Rattus norvegicus OX=10116 GN=Nr1h3 PE=1 SV=1
12	Q62755	0.0	531	446	0.620	0.621	NR1H2_RAT Oxysterols receptor LXR-beta OS=Rattus norvegicus OX=10116 GN=Nr1h2 PE=2 SV=1
13	Q8JHU1	0.0	639	409	0.694	0.758	Q8JHU1_CHICK Liver X receptor OS=Gallus gallus OX=9031 GN=LXR PE=1 SV=1
14	Q9Z0Y9	0.0	842	445	0.915	0.919	NR1H3_MOUSE Oxysterols receptor LXR-alpha OS=Mus musculus OX=10090 GN=Nr1h3 PE=1 SV=3
15	C9JBS2	4.44e-156	442	212	0.474	1.000	C9JBS2_HUMAN Nuclear receptor subfamily 1 group H member 3 (Fragment) OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
16	C9JCS0	1.29e-150	428	205	0.459	1.000	C9JCS0_HUMAN Nuclear receptor subfamily 1 group H member 3 (Fragment) OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
17	C9JJ16	1.57e-148	422	202	0.452	1.000	C9JJ16_HUMAN Nuclear receptor subfamily 1 group H member 3 (Fragment) OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=1
18	C9J4R0	9.54e-142	405	193	0.432	1.000	C9J4R0_HUMAN Nuclear receptor subfamily 1 group H member 3 (Fragment) OS=Homo sapiens OX=9606 GN=NR1H3 PE=1 SV=8
19	P34021	7.88e-89	290	878	0.369	0.188	ECR_DROME Ecdysone receptor OS=Drosophila melanogaster OX=7227 GN=EcR PE=1 SV=1
20	O18473	7.48e-88	280	576	0.362	0.281	ECR_HELVI Ecdysone receptor OS=Heliothis virescens OX=7102 GN=EcR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	4.9e-25	99.9	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1.2e-23	94.6	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003815234.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008974288.1	0.995	Retinoic acid receptor RXR-alpha isoform X1
2	9597.XP_008950641.1	0.988	Nuclear receptor coactivator 1
3	9597.XP_008958903.1	0.974	Retinoic acid receptor RXR-beta isoform X1
4	9597.XP_003824630.1	0.925	Retinoid X receptor gamma
5	9597.XP_003813668.1	0.923	Nuclear receptor subfamily 1 group H member 2
6	9597.XP_008969376.1	0.912	Nuclear receptor corepressor 2
7	9597.XP_003809287.1	0.898	ATP binding cassette subfamily A member 1
8	9597.XP_008950430.1	0.889	PPARG coactivator 1 alpha
9	9597.XP_003819241.1	0.886	Nuclear receptor interacting protein 1
10	9597.XP_003831576.1	0.868	Mediator of RNA polymerase II transcription subunit 1
11	9597.XP_003823940.1	0.862	ATP-binding cassette sub-family G member 1 isoform X1
12	9597.XP_003820129.1	0.861	Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility (By similarity)
13	9597.XP_003831386.1	0.860	Nuclear receptor coactivator 2 isoform X1
14	9597.XP_003808829.1	0.858	Sterol regulatory element binding transcription factor 1
15	9597.XP_003812430.1	0.858	Peroxisome proliferator activated receptor alpha
16	9597.XP_003831208.1	0.857	Nuclear receptor corepressor 1-like
17	9597.XP_003833416.1	0.857	Putative nuclear receptor corepressor 1-like protein NCOR1P1
18	9597.XP_008962848.1	0.857	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
19	9597.XP_003820179.1	0.848	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit isoform X1
20	9597.XP_003809171.1	0.845	ATP binding cassette subfamily G member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0004879	0.997	nuclear receptor activity
GO:0001216	0.712	DNA-binding transcription activator activity
GO:0001228	0.559	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008134	0.523	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0080090	0.988	regulation of primary metabolic process
GO:0009889	0.986	regulation of biosynthetic process
GO:0050794	0.985	regulation of cellular process
GO:0010468	0.982	regulation of gene expression
GO:0031323	0.980	regulation of cellular metabolic process
GO:0048522	0.978	positive regulation of cellular process
GO:0009987	0.977	cellular process
GO:0051171	0.961	regulation of nitrogen compound metabolic process
GO:0009893	0.961	positive regulation of metabolic process
GO:0031326	0.961	regulation of cellular biosynthetic process
GO:0050896	0.953	response to stimulus
GO:0008152	0.947	metabolic process
GO:0071704	0.920	organic substance metabolic process
GO:0044238	0.915	primary metabolic process
GO:0048519	0.901	negative regulation of biological process
GO:0006355	0.893	regulation of DNA-templated transcription
GO:0010604	0.884	positive regulation of macromolecule metabolic process
GO:0032879	0.862	regulation of localization
GO:0006357	0.754	regulation of transcription by RNA polymerase II
GO:0031325	0.737	positive regulation of cellular metabolic process
GO:0051716	0.734	cellular response to stimulus
GO:0042221	0.724	response to chemical
GO:0007154	0.724	cell communication
GO:0010883	0.711	regulation of lipid storage
GO:0023052	0.708	signaling
GO:1905952	0.689	regulation of lipid localization
GO:0010033	0.681	response to organic substance
GO:0032368	0.664	regulation of lipid transport
GO:0044237	0.643	cellular metabolic process
GO:0006629	0.633	lipid metabolic process
GO:1901700	0.630	response to oxygen-containing compound
GO:0032371	0.621	regulation of sterol transport
GO:0009891	0.585	positive regulation of biosynthetic process
GO:0051173	0.579	positive regulation of nitrogen compound metabolic process
GO:0045935	0.560	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.559	negative regulation of cellular process
GO:0031328	0.558	positive regulation of cellular biosynthetic process
GO:1905954	0.551	positive regulation of lipid localization
GO:0051254	0.539	positive regulation of RNA metabolic process
GO:0009892	0.512	negative regulation of metabolic process
GO:0051050	0.509	positive regulation of transport
GO:0032370	0.495	positive regulation of lipid transport
GO:0006807	0.483	nitrogen compound metabolic process
GO:0010557	0.462	positive regulation of macromolecule biosynthetic process
GO:0045893	0.453	positive regulation of DNA-templated transcription
GO:0048583	0.450	regulation of response to stimulus
GO:0070887	0.436	cellular response to chemical stimulus
GO:0007165	0.410	signal transduction
GO:0010605	0.386	negative regulation of macromolecule metabolic process
GO:0032501	0.362	multicellular organismal process
GO:0055088	0.351	lipid homeostasis
GO:0045944	0.351	positive regulation of transcription by RNA polymerase II
GO:0051239	0.341	regulation of multicellular organismal process
GO:0032374	0.333	regulation of cholesterol transport
GO:0031324	0.326	negative regulation of cellular metabolic process
GO:0032373	0.325	positive regulation of sterol transport
GO:0051172	0.322	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.999	intracellular organelle lumen
GO:0005654	0.991	nucleoplasm
GO:0005829	0.990	cytosol
GO:0032991	0.650	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]