StarFunc result for job id Q13136

User Input

>input (1202 residues)
MMCEVMPTISEAEGPPGGGGGHGSGSPSQPDADSHFEQLMVSMLEERDRLLDTLRETQET
LALTQGKLHEVGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNN
TRLLLEHLECLVSRHERSLRMTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRE
RLRVALERCSLLEEELGATHKELMILKEQNNQKKTLTDGVLDINHEQENTPSTSGKRSSD
GSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHVTELEEDLDTARKDLIKSEEM
NTKLQRDVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEIANKDSMHRQT
EDKNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQME
AQLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLL
REVESAKKQLEETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPMAD
GHTDSYSTSAVLRRPQKGRLAALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDADV
SDGEDDRDTLLSSVDLLSPSGQADAHTLAMMLQEQLDAINKEIRLIQEEKENTEQRAEEI
ESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRSTPRRIPHSPAREVDRLGVMT
LLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDIRNSTGSQDGP
VSNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGQTGKEALGQAGVSETDNSSQ
DALGLSKLGGQAEKNRKLQKKHELLEEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAA
CRANVKSGAIMSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYG
DMNHEWIGNEWLPSLGLPQYRSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCG
IMCLRRLNYDRKELERKREESQSEIKDVLVWSNDRVIRWILSIGLKEYANNLIESGVHGA
LLALDETFDFSALALLLQIPTQNTQARAVLEREFNNLLVMGTDRRFDEDDDKSFRRAPSW
RKKFRPKDIRGLAAGSAETLPANFRVTSSMSSPSMQPKKMQMDGNVSGTQRLDSATVRTY
SC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K3L9	0.245	0.240	0.000	1226	0.961	0.942	A0A0G2K3L9.pdb.gz	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
2	AFDB:B2RXW8	0.257	0.250	0.000	1241	0.958	0.927	B2RXW8.pdb.gz	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
3	AFDB:B8QI33	0.251	0.239	0.000	1267	0.958	0.908	B8QI33.pdb.gz	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
4	AFDB:Q13136	1.000	1.000	0.000	1202	1.000	1.000	Q13136.pdb.gz	LIPA1_HUMAN Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1
5	AFDB:O75334	0.261	0.251	3.056E-100	1257	0.706	0.675	O75334.pdb.gz	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
6	AFDB:B8QI36	0.292	0.296	2.902E-94	1187	0.655	0.663	B8QI36.pdb.gz	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
7	AFDB:X1WCJ5	0.321	0.316	1.579E-93	1226	0.643	0.631	X1WCJ5.pdb.gz	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
8	AFDB:O75335	0.275	0.277	2.543E-93	1185	0.641	0.650	O75335.pdb.gz	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3
9	AFDB:Q69ZW5	0.297	0.312	2.004E-92	1140	0.627	0.661	Q69ZW5.pdb.gz	Q69ZW5_MOUSE MKIAA0897 protein (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=2 SV=1
10	AFDB:O75145	0.271	0.273	2.753E-92	1194	0.617	0.621	O75145.pdb.gz	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
11	PDB:7cm7A	0.069	0.106	1.776E-2	620	0.041	0.079	7cm7A.pdb.gz	The NAD + -mediated self-inhibition mechanism of pro-neurodegenerative SARM1.
12	PDB:3bs5A	0.051	0.596	1.328E-1	86	0.013	0.186	3bs5A.pdb.gz
13	PDB:6wpkA	0.067	0.123	1.641E-1	547	0.024	0.053	6wpkA.pdb.gz
14	PDB:7anwA	0.066	0.100	3.097E-1	645	0.036	0.067	7anwA.pdb.gz	Structural basis for SARM1 inhibition and activation under energetic stress.
15	PDB:7zs9M	0.057	0.172	5.845E-1	310	0.029	0.113	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
16	PDB:2dh4A	0.054	0.120	1.777	326	0.027	0.101	2dh4A.pdb.gz	Crystal Structure of Type-III Geranylgeranyl Pyrophosphate Synthase from Saccharomyces cerevisiae and the Mechanism of Product Chain Length Determination.
17	PDB:6xz6A	0.039	0.146	1.777	213	0.014	0.080	6xz6A.pdb.gz
18	PDB:5nx7A	0.055	0.121	1.873	308	0.033	0.130	5nx7A.pdb.gz	Structural Basis of Catalysis in the Bacterial Monoterpene Synthases Linalool Synthase and 1,8-Cineole Synthase.
19	PDB:2qb0B	0.052	0.225	2.082	241	0.031	0.154	2qb0B.pdb.gz	Polymer-driven crystallization.
20	PDB:5iy6M	0.067	0.174	2.315	260	0.021	0.096	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WPJ3	1089	892	0.489	0.659	A0A087WPJ3_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 (Fragment) OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
2	A0A087WPM2	1412	1184	0.651	0.661	A0A087WPM2_MOUSE Protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF),-interacting protein (liprin), alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
3	A0A0G2K3L9	2113	1142	0.903	0.951	A0A0G2K3L9_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
4	A0A1B0GWM2	2112	1218	0.917	0.905	A0A1B0GWM2_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=2
5	A0A1B0GWS0	2217	1266	0.961	0.912	A0A1B0GWS0_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
6	A0A2R8Y7R9	2384	1224	0.984	0.967	A0A2R8Y7R9_HUMAN PTPRF interacting protein alpha 1 (Fragment) OS=Homo sapiens OX=9606 GN=PPFIA1 PE=1 SV=1
7	A0A8I6AK94	1570	1261	0.698	0.665	A0A8I6AK94_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
8	A0A8I6AM56	1554	1246	0.688	0.664	A0A8I6AM56_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=3 SV=1
9	B2RXQ2	2211	1266	0.958	0.910	B2RXQ2_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
10	B2RXW8	2224	1241	0.958	0.928	B2RXW8_MOUSE Ppfia1 protein OS=Mus musculus OX=10090 GN=Ppfia1 PE=1 SV=1
11	B8QI33	2212	1267	0.958	0.909	B8QI33_MOUSE Liprin-alpha 1 OS=Mus musculus OX=10090 GN=Ppfia1 PE=2 SV=1
12	B8QI36	1432	1187	0.664	0.672	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
13	D3ZZ81	2217	1190	0.947	0.956	D3ZZ81_RAT PTPRF interacting protein alpha 1 OS=Rattus norvegicus OX=10116 GN=Ppfia1 PE=1 SV=1
14	F1M8A4	1489	1126	0.643	0.687	F1M8A4_RAT PTPRF interacting protein alpha 2 OS=Rattus norvegicus OX=10116 GN=Ppfia2 PE=1 SV=3
15	M9PC73	1015	1158	0.521	0.541	M9PC73_DROME Liprin-alpha, isoform C OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
16	M9PCD4	1058	1214	0.533	0.528	M9PCD4_DROME Liprin-alpha, isoform E OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
17	M9PCR7	1053	1205	0.533	0.532	M9PCR7_DROME Liprin-alpha, isoform D OS=Drosophila melanogaster OX=7227 GN=Liprin-alpha PE=1 SV=1
18	O75145	1371	1194	0.633	0.637	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
19	O75334	1578	1257	0.700	0.669	LIPA2_HUMAN Liprin-alpha-2 OS=Homo sapiens OX=9606 GN=PPFIA2 PE=1 SV=2
20	O75335	1361	1185	0.645	0.654	LIPA4_HUMAN Liprin-alpha-4 OS=Homo sapiens OX=9606 GN=PPFIA4 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	1.1e-21	88.4	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	8.5e-18	75.6	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253925

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349932	0.996	Receptor-type tyrosine-protein phosphatase S
2	9606.ENSP00000353030	0.995	Receptor-type tyrosine-protein phosphatase F
3	9606.ENSP00000324804	0.993	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
4	9606.ENSP00000418447	0.993	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
5	9606.ENSP00000367408	0.974	Peripheral plasma membrane protein CASK
6	9606.ENSP00000468263	0.973	ELKS/Rab6-interacting/CAST family member 1
7	9606.ENSP00000370593	0.966	Receptor-type tyrosine-protein phosphatase delta
8	9606.ENSP00000265381	0.962	Amyloid-beta A4 precursor protein-binding family A member 1
9	9606.ENSP00000378338	0.959	ARF GTPase-activating protein GIT1
10	9606.ENSP00000278193	0.952	Protein lin-7 homolog C
11	9606.ENSP00000447488	0.938	Protein lin-7 homolog A
12	9606.ENSP00000221459	0.918	Protein lin-7 homolog B
13	9606.ENSP00000367756	0.903	Protein unc-13 homolog B
14	9606.ENSP00000417963	0.873	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
15	9606.ENSP00000288221	0.870	ERC protein 2
16	9606.ENSP00000279147	0.854	The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery . May be required for biogenesis of the large ribosomal subunit and initiation of translation . May play a role in the regulation of proline metabolism and ROS production .
17	9606.ENSP00000428417	0.853	Regulating synaptic membrane exocytosis protein 1
18	9606.ENSP00000438388	0.846	Kinesin-like protein KIF1A
19	9606.ENSP00000380024	0.842	Inhibitor of growth protein 4
20	9606.ENSP00000314724	0.841	Liprin-beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.994	biological regulation
GO:0050794	0.972	regulation of cellular process
GO:0009987	0.839	cellular process
GO:0065008	0.406	regulation of biological quality
GO:0032501	0.389	multicellular organismal process
GO:0032502	0.378	developmental process
GO:0051128	0.337	regulation of cellular component organization
GO:0048523	0.329	negative regulation of cellular process
GO:0007154	0.324	cell communication
GO:0048856	0.309	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.999	synapse
GO:0012505	0.998	endomembrane system
GO:0043226	0.995	organelle
GO:0032991	0.990	protein-containing complex
GO:0016020	0.990	membrane
GO:0005737	0.980	cytoplasm
GO:0043227	0.978	membrane-bounded organelle
GO:0005829	0.957	cytosol
GO:0043229	0.940	intracellular organelle
GO:0098793	0.934	presynapse
GO:0005886	0.898	plasma membrane
GO:0043231	0.880	intracellular membrane-bounded organelle
GO:0042995	0.757	cell projection
GO:0120025	0.709	plasma membrane bounded cell projection
GO:0043005	0.634	neuron projection
GO:0031982	0.606	vesicle
GO:0005925	0.447	focal adhesion
GO:0048786	0.442	presynaptic active zone
GO:0098794	0.353	postsynapse
GO:0036477	0.312	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]