StarFunc result for job id Q13137

User Input

>input (446 residues)
MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFR
VGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGAS
IPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKK
QEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQ
EKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLEQTVEQMKQNETTAMKKQ
QELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMGLDFNSLPYQV
PTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF
NCPICDKIFPATEKQIFEDHVFCHSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q13137	1.000	1.000	1.029E-63	446	1.000	1.000	Q13137.pdb.gz	CACO2_HUMAN Calcium-binding and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CALCOCO2 PE=1 SV=1
2	AFDB:Q9I8F3	0.268	0.229	1.975E-16	539	0.224	0.186	Q9I8F3.pdb.gz	Q9I8F3_CHICK Muscle-derived protein 62 OS=Gallus gallus OX=9031 GN=MDP62 PE=2 SV=1
3	AFDB:Q86VP1	0.267	0.163	2.356E-16	789	0.276	0.156	Q86VP1.pdb.gz	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
4	AFDB:Q3UKC1	0.270	0.161	3.996E-16	814	0.289	0.158	Q3UKC1.pdb.gz	TAXB1_MOUSE Tax1-binding protein 1 homolog OS=Mus musculus OX=10090 GN=Tax1bp1 PE=1 SV=2
5	AFDB:A0A024RAZ1	0.272	0.188	1.023E-15	691	0.307	0.198	A0A024RAZ1.pdb.gz
6	AFDB:Q8CGU1	0.242	0.158	2.467E-15	691	0.303	0.195	Q8CGU1.pdb.gz	CACO1_MOUSE Calcium-binding and coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Calcoco1 PE=1 SV=2
7	PDB:5ir3A	0.142	0.409	1.751E-3	111	0.034	0.135	5ir3A.pdb.gz
8	AFDB:Q90712	0.271	0.278	5.132E-3	433	0.130	0.134	Q90712.pdb.gz	Q90712_CHICK Zipper protein OS=Gallus gallus OX=9031 PE=2 SV=1
9	PDB:4ziqA	0.180	0.059	6.759E-3	1450	0.020	0.006	4ziqA.pdb.gz
10	PDB:3oaiA	0.139	0.129	8.549E-3	488	0.031	0.029	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
11	PDB:1ogpA	0.133	0.150	1.020E-2	388	0.038	0.044	1ogpA.pdb.gz	The Crystal Structure of Plant Sulfite Oxidase Provides Insights Into Sulfite Oxidation in Plants and Animals
12	PDB:3tygL	0.152	0.277	1.147E-2	207	0.034	0.072	3tygL.pdb.gz	A potent and broad neutralizing antibody recognizes and penetrates the HIV glycan shield.
13	PDB:1ezvX	0.166	0.436	1.289E-2	127	0.036	0.126	1ezvX.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
14	PDB:3zhlA	0.157	0.434	1.730E-2	121	0.034	0.124	3zhlA.pdb.gz
15	PDB:5kwyC	0.159	0.422	1.945E-2	133	0.036	0.120	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
16	PDB:1aqkL	0.125	0.220	2.187E-2	216	0.029	0.060	1aqkL.pdb.gz
17	AFDB:P32618	0.242	0.127	2.362E-2	956	0.126	0.059	P32618.pdb.gz	YEF3_YEAST Uncharacterized protein YEL043W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YEL043W PE=1 SV=1
18	PDB:1bd2D	0.163	0.327	2.609E-2	190	0.036	0.084	1bd2D.pdb.gz	Two human T cell receptors bind in a similar diagonal mode to the HLA-A2/Tax peptide complex using different TCR amino acids.
19	AFDB:Q8NFZ5	0.167	0.173	2.988E-2	429	0.101	0.105	Q8NFZ5.pdb.gz	TNIP2_HUMAN TNFAIP3-interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1
20	AFDB:D6RGJ2	0.217	0.270	1.026E-1	346	0.126	0.162	D6RGJ2.pdb.gz	D6RGJ2_HUMAN TNFAIP3 interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6REB0	0.0	509	259	0.581	1.000	D6REB0_HUMAN Calcium binding and coiled-coil domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=CALCOCO2 PE=1 SV=1
2	Q13137	0.0	920	446	1.000	1.000	CACO2_HUMAN Calcium-binding and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CALCOCO2 PE=1 SV=1
3	Q9I8F3	1.73e-41	156	539	0.170	0.141	Q9I8F3_CHICK Muscle-derived protein 62 OS=Gallus gallus OX=9031 GN=MDP62 PE=2 SV=1
4	Q86VP1	4.24e-39	152	789	0.231	0.131	TAXB1_HUMAN Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1 PE=1 SV=2
5	Q66HA4	7.01e-37	145	813	0.213	0.117	TAXB1_RAT Tax1-binding protein 1 homolog OS=Rattus norvegicus OX=10116 GN=Tax1bp1 PE=2 SV=1
6	Q3UKC1	1.77e-36	144	814	0.209	0.114	TAXB1_MOUSE Tax1-binding protein 1 homolog OS=Mus musculus OX=10090 GN=Tax1bp1 PE=1 SV=2
7	Q9P1Z2	2.27e-28	120	691	0.220	0.142	CACO1_HUMAN Calcium-binding and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CALCOCO1 PE=1 SV=2
8	Q8CGU1	1.43e-27	118	691	0.204	0.132	CACO1_MOUSE Calcium-binding and coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Calcoco1 PE=1 SV=2
9	Q9JIR0	5.92e-06	51.2	1847	0.105	0.025	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
10	Q7TNF8	1.25e-05	50.4	1846	0.137	0.033	RIMB1_MOUSE Peripheral-type benzodiazepine receptor-associated protein 1 OS=Mus musculus OX=10090 GN=Tspoap1 PE=2 SV=2
11	O95153	2.27e-05	49.7	1857	0.137	0.033	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
12	Q9USI6	6.63e-05	48.1	1526	0.135	0.039	MYO2_SCHPO Myosin type-2 heavy chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo2 PE=1 SV=1
13	H0YM23	7.78e-05	47.8	2487	0.092	0.016	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
14	Q6VGS5	8.25e-05	47.8	2009	0.139	0.031	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
15	O75179	8.88e-05	47.8	2603	0.092	0.016	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
16	Q99NH0	3.82e-04	45.4	2603	0.065	0.011	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
17	Q5TZA2	0.001	43.9	2017	0.092	0.020	CROCC_HUMAN Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=2
18	Q6A087	0.001	43.5	1972	0.121	0.027	Q6A087_MOUSE MKIAA0302 protein (Fragment) OS=Mus musculus OX=10090 GN=Sptbn2 PE=2 SV=1
19	F6W8M4	0.003	42.7	2390	0.121	0.023	F6W8M4_MACMU Spectrin beta chain OS=Macaca mulatta OX=9544 GN=SPTBN2 PE=3 SV=3
20	O15020	0.004	42.4	2390	0.121	0.023	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02183 HALZ	3.3e+02	12.9	Homeobox associated leucine zipper
2	PF13460 NAD_binding_10	2.4e+02	13.0	NAD(P)H-binding
3	PF17751 SKICH	2.6e-27	106.7	SKICH domain
4	PF18112 Zn-C2H2_12	1.5	20.5	Autophagy receptor zinc finger-C2H2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000015914

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000003612	0.984	Galectin
2	9598.ENSPTRP00000008798	0.983	TANK-binding kinase 1
3	9598.ENSPTRP00000043304	0.968	Microtubule-associated protein 1 light chain 3 gamma
4	9598.ENSPTRP00000014277	0.949	GABA(A) receptor-associated protein-like 2
5	9598.ENSPTRP00000060094	0.937	GABA(A) receptor-associated protein like 1
6	9598.ENSPTRP00000014784	0.935	GABA(A) receptor-associated protein
7	9598.ENSPTRP00000015868	0.844	TBK1 binding protein 1
8	9598.ENSPTRP00000034671	0.801	RB1-inducible coiled-coil 1
9	9598.ENSPTRP00000009162	0.779	PWP1 homolog
10	9598.ENSPTRP00000009697	0.779	Crystallin, lambda 1
11	9598.ENSPTRP00000025369	0.770	Uncharacterized protein
12	9598.ENSPTRP00000057782	0.770	Mitochondrial poly(A) polymerase
13	9598.ENSPTRP00000010508	0.765	DDB1 and CUL4 associated factor 11
14	9598.ENSPTRP00000004825	0.762	Uncharacterized protein
15	9598.ENSPTRP00000007818	0.755	TAP binding protein-like
16	9598.ENSPTRP00000033326	0.746	Adaptor-related protein complex 4, mu 1 subunit
17	9598.ENSPTRP00000026367	0.745	Deltex 3 like, E3 ubiquitin ligase
18	9598.ENSPTRP00000002112	0.739	OTU deubiquitinase 7B
19	9598.ENSPTRP00000011141	0.738	Uncharacterized protein
20	9598.ENSPTRP00000049477	0.730	Glycine cleavage system P protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	0.999	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0044237	0.993	cellular metabolic process
GO:0061919	0.989	process utilizing autophagic mechanism
GO:0009894	0.986	regulation of catabolic process
GO:0050896	0.985	response to stimulus
GO:0016236	0.984	macroautophagy
GO:0031325	0.983	positive regulation of cellular metabolic process
GO:0051128	0.967	regulation of cellular component organization
GO:0006950	0.965	response to stress
GO:0010506	0.964	regulation of autophagy
GO:0009605	0.930	response to external stimulus
GO:0016241	0.920	regulation of macroautophagy
GO:0044419	0.918	biological process involved in interspecies interaction between organisms
GO:0031331	0.913	positive regulation of cellular catabolic process
GO:0010508	0.885	positive regulation of autophagy
GO:0016239	0.877	positive regulation of macroautophagy
GO:0051130	0.859	positive regulation of cellular component organization
GO:0006952	0.828	defense response
GO:0051707	0.826	response to other organism
GO:0098542	0.824	defense response to other organism
GO:0002376	0.800	immune system process
GO:0043244	0.798	regulation of protein-containing complex disassembly
GO:0006955	0.776	immune response
GO:0045087	0.764	innate immune response
GO:0042221	0.762	response to chemical
GO:0010033	0.753	response to organic substance
GO:0034341	0.732	response to type II interferon
GO:0033043	0.554	regulation of organelle organization
GO:0061912	0.489	selective autophagy
GO:0016032	0.362	viral process
GO:0043243	0.359	positive regulation of protein-containing complex disassembly
GO:0060255	0.357	regulation of macromolecule metabolic process
GO:0051716	0.345	cellular response to stimulus
GO:0051171	0.339	regulation of nitrogen compound metabolic process
GO:0010638	0.339	positive regulation of organelle organization
GO:0071704	0.324	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.998	membrane
GO:0005634	0.998	nucleus
GO:0005654	0.994	nucleoplasm
GO:0005773	0.944	vacuole
GO:0016604	0.779	nuclear body
GO:0005776	0.730	autophagosome
GO:0016605	0.727	PML body
GO:0048471	0.670	perinuclear region of cytoplasm
GO:0031090	0.412	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]