StarFunc result for job id Q13144

User Input

>input (721 residues)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A3B3IUB1	0.710	0.703	0.000	729	1.000	0.989	A0A3B3IUB1.pdb.gz	A0A3B3IUB1_HUMAN eIF-2B GDP-GTP exchange factor subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=1
2	AFDB:Q8CHW4	0.937	0.942	0.000	717	0.878	0.883	Q8CHW4.pdb.gz	EI2BE_MOUSE Translation initiation factor eIF-2B subunit epsilon OS=Mus musculus OX=10090 GN=Eif2b5 PE=1 SV=1
3	PDB:7f66J	0.596	0.725	4.895E-92	591	0.818	0.998	7f66J.pdb.gz
4	AFDB:P56287	0.636	0.674	2.389E-61	678	0.316	0.336	P56287.pdb.gz	EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif225 PE=1 SV=1
5	AFDB:P32501	0.654	0.662	1.592E-53	712	0.272	0.275	P32501.pdb.gz	EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD6 PE=1 SV=1
6	AFDB:Q9W541	0.560	0.603	6.313E-53	669	0.290	0.312	Q9W541.pdb.gz	Q9W541_DROME eIF-2B GDP-GTP exchange factor subunit epsilon OS=Drosophila melanogaster OX=7227 GN=eIF2Bepsilon PE=1 SV=1
7	PDB:6jlzI	0.550	0.913	1.627E-40	430	0.230	0.386	6jlzI.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
8	PDB:6qg0I	0.531	0.875	1.842E-32	431	0.200	0.334	6qg0I.pdb.gz	Structural basis for the inhibition of translation through eIF2 alpha phosphorylation.
9	AFDB:P56288	0.456	0.700	6.562E-24	458	0.128	0.201	P56288.pdb.gz	EI2BG_SCHPO Probable translation initiation factor eIF-2B subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif223 PE=1 SV=2
10	AFDB:P70541	0.426	0.655	9.281E-23	452	0.121	0.192	P70541.pdb.gz	EI2BG_RAT Translation initiation factor eIF-2B subunit gamma OS=Rattus norvegicus OX=10116 GN=Eif2b3 PE=2 SV=2
11	AFDB:P80361	0.445	0.759	5.489E-21	404	0.112	0.200	P80361.pdb.gz	EI2BG_CAEEL Probable translation initiation factor eIF-2B subunit gamma OS=Caenorhabditis elegans OX=6239 GN=eif-2Bgamma PE=2 SV=3
12	AFDB:A1ZA22	0.421	0.642	8.842E-21	455	0.108	0.171	A1ZA22.pdb.gz	A1ZA22_DROME Eukaryotic translation initiation factor 2B subunit gamma OS=Drosophila melanogaster OX=7227 GN=eIF2Bgamma PE=1 SV=1
13	AFDB:P09032	0.425	0.521	2.240E-19	578	0.100	0.125	P09032.pdb.gz	EI2BG_YEAST Translation initiation factor eIF-2B subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD1 PE=1 SV=3
14	PDB:5b04E	0.414	0.737	8.379E-18	384	0.105	0.198	5b04E.pdb.gz
15	PDB:6jlyE	0.452	0.760	1.582E-17	414	0.108	0.188	6jlyE.pdb.gz	Structural basis for eIF2B inhibition in integrated stress response.
16	PDB:7d45F	0.407	0.786	7.756E-17	350	0.103	0.211	7d45F.pdb.gz
17	PDB:7d72A	0.356	0.583	1.249E-16	407	0.103	0.182	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:7x8kB	0.329	0.578	2.488E-16	367	0.092	0.180	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
19	PDB:7d72K	0.381	0.716	6.646E-15	360	0.078	0.156	7d72K.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
20	PDB:7rloI	0.275	0.757	1.162E-13	238	0.067	0.202	7rloI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3IUB1	0.0	1490	729	1.000	0.989	A0A3B3IUB1_HUMAN eIF-2B GDP-GTP exchange factor subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=1
2	P47823	0.0	1298	721	0.892	0.892	EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus OX=9986 GN=EIF2B5 PE=1 SV=1
3	Q13144	0.0	1497	721	1.000	1.000	EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens OX=9606 GN=EIF2B5 PE=1 SV=3
4	Q64350	0.0	1273	716	0.878	0.884	EI2BE_RAT Translation initiation factor eIF-2B subunit epsilon OS=Rattus norvegicus OX=10116 GN=Eif2b5 PE=1 SV=2
5	Q8CHW4	0.0	1254	717	0.842	0.847	EI2BE_MOUSE Translation initiation factor eIF-2B subunit epsilon OS=Mus musculus OX=10090 GN=Eif2b5 PE=1 SV=1
6	P56287	1.03e-119	375	678	0.322	0.342	EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif225 PE=1 SV=1
7	Q9W541	4.07e-94	308	669	0.304	0.327	Q9W541_DROME eIF-2B GDP-GTP exchange factor subunit epsilon OS=Drosophila melanogaster OX=7227 GN=eIF2Bepsilon PE=1 SV=1
8	Q9GQ87	1.95e-90	298	668	0.300	0.323	Q9GQ87_DROME eIF-2B GDP-GTP exchange factor subunit epsilon OS=Drosophila melanogaster OX=7227 GN=eIF2Bepsilon PE=2 SV=1
9	P32501	1.59e-88	294	712	0.290	0.294	EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCD6 PE=1 SV=1
10	P56288	7.05e-12	70.5	458	0.129	0.203	EI2BG_SCHPO Probable translation initiation factor eIF-2B subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif223 PE=1 SV=2
11	P70541	1.09e-08	60.5	452	0.130	0.208	EI2BG_RAT Translation initiation factor eIF-2B subunit gamma OS=Rattus norvegicus OX=10116 GN=Eif2b3 PE=2 SV=2
12	Q4QBG5	4.56e-07	55.1	379	0.119	0.227	Q4QBG5_LEIMA mannose-1-phosphate guanylyltransferase OS=Leishmania major OX=5664 GN=GDPMP PE=3 SV=1
13	Q7D5T3	2.61e-06	52.8	359	0.118	0.237	Q7D5T3_MYCTO Mannose-1-phosphate guanyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=mpg1 PE=4 SV=1
14	Q4LE58	4.70e-05	49.3	1624	0.068	0.030	Q4LE58_HUMAN eIF4G1 variant protein (Fragment) OS=Homo sapiens OX=9606 GN=EIF4G1 variant protein PE=2 SV=1
15	B2RU10	5.24e-05	49.3	1606	0.068	0.031	B2RU10_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
16	O74484	5.48e-05	48.5	363	0.054	0.107	MPG1_SCHPO Mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mpg1 PE=2 SV=1
17	B2RU06	5.80e-05	49.3	1606	0.068	0.031	B2RU06_HUMAN eIF4G1 protein OS=Homo sapiens OX=9606 GN=EIF4G1 PE=2 SV=1
18	Q04637	5.95e-05	49.3	1599	0.068	0.031	IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4
19	E7EUU4	6.03e-05	49.3	1560	0.068	0.031	E7EUU4_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
20	E9PGM1	6.21e-05	48.9	1513	0.068	0.032	E9PGM1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16314 DUF4954	2	18.1	Domain of unknown function (DUF4954)
2	PF07959 Fucokinase	94	13.4	L-fucokinase
3	PF00132 Hexapep	4e-07	40.7	Bacterial transferase hexapeptide (six repeats)
4	PF14602 Hexapep_2	26	15.9	Hexapeptide repeat of succinyl-transferase
5	PF00483 NTP_transferase	10	17.2	Nucleotidyl transferase
6	PF02020 W2	5.6e-16	69.8	eIF4-gamma/eIF5/eIF2-epsilon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273783

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253039	0.999	Eukaryotic translation initiation factor 2 subunit 3
2	9606.ENSP00000256383	0.999	Eukaryotic translation initiation factor 2 subunit 1
3	9606.ENSP00000266126	0.999	Translation initiation factor eIF-2B subunit beta
4	9606.ENSP00000353575	0.999	Translation initiation factor eIF-2B subunit gamma
5	9606.ENSP00000364119	0.999	Eukaryotic translation initiation factor 2 subunit 2
6	9606.ENSP00000394869	0.999	Translation initiation factor eIF-2B subunit delta
7	9606.ENSP00000416250	0.999	Translation initiation factor eIF-2B subunit alpha
8	9606.ENSP00000324806	0.974	Glycogen synthase kinase-3 beta
9	9606.ENSP00000445077	0.913	Putative eukaryotic translation initiation factor 2 subunit 3-like protein
10	9606.ENSP00000216554	0.910	Eukaryotic translation initiation factor 5
11	9606.ENSP00000263791	0.868	eIF-2-alpha kinase GCN2
12	9606.ENSP00000419449	0.745	Eukaryotic translation initiation factor 1
13	9606.ENSP00000362688	0.706	Eukaryotic translation initiation factor 3 subunit I
14	9606.ENSP00000416255	0.704	Eukaryotic translation initiation factor 4 gamma 1
15	9606.ENSP00000354125	0.683	Eukaryotic translation initiation factor 3 subunit B
16	9606.ENSP00000355512	0.681	Opsin-3
17	9606.ENSP00000381932	0.672	Dual specificity tyrosine-phosphorylation-regulated kinase 1A
18	9606.ENSP00000311977	0.657	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like
19	9606.ENSP00000425561	0.644	Eukaryotic translation initiation factor 4E
20	9606.ENSP00000342105	0.634	Dual specificity tyrosine-phosphorylation-regulated kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0003676	0.997	nucleic acid binding
GO:0045182	0.995	translation regulator activity
GO:0003743	0.991	translation initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0048518	0.979	positive regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0019222	0.871	regulation of metabolic process
GO:0009987	0.868	cellular process
GO:0044237	0.832	cellular metabolic process
GO:0071704	0.825	organic substance metabolic process
GO:0044238	0.815	primary metabolic process
GO:0060255	0.808	regulation of macromolecule metabolic process
GO:0006807	0.772	nitrogen compound metabolic process
GO:0031323	0.757	regulation of cellular metabolic process
GO:0080090	0.745	regulation of primary metabolic process
GO:0009058	0.691	biosynthetic process
GO:0043170	0.666	macromolecule metabolic process
GO:0051171	0.666	regulation of nitrogen compound metabolic process
GO:0048522	0.650	positive regulation of cellular process
GO:0044249	0.648	cellular biosynthetic process
GO:1901576	0.645	organic substance biosynthetic process
GO:0010556	0.637	regulation of macromolecule biosynthetic process
GO:0031326	0.637	regulation of cellular biosynthetic process
GO:2000112	0.630	regulation of cellular macromolecule biosynthetic process
GO:0051246	0.629	regulation of protein metabolic process
GO:0010468	0.628	regulation of gene expression
GO:0050896	0.586	response to stimulus
GO:1901564	0.572	organonitrogen compound metabolic process
GO:0006417	0.559	regulation of translation
GO:0034641	0.548	cellular nitrogen compound metabolic process
GO:0044260	0.528	cellular macromolecule metabolic process
GO:0034645	0.519	cellular macromolecule biosynthetic process
GO:0044271	0.510	cellular nitrogen compound biosynthetic process
GO:0019538	0.507	protein metabolic process
GO:0032501	0.493	multicellular organismal process
GO:0032502	0.488	developmental process
GO:0009893	0.473	positive regulation of metabolic process
GO:0006518	0.448	peptide metabolic process
GO:0010604	0.445	positive regulation of macromolecule metabolic process
GO:0051173	0.424	positive regulation of nitrogen compound metabolic process
GO:0031325	0.419	positive regulation of cellular metabolic process
GO:0010467	0.413	gene expression
GO:0048856	0.394	anatomical structure development
GO:0006950	0.390	response to stress
GO:0010557	0.375	positive regulation of macromolecule biosynthetic process
GO:0006412	0.375	translation
GO:0031328	0.369	positive regulation of cellular biosynthetic process
GO:0051716	0.349	cellular response to stimulus
GO:0010628	0.337	positive regulation of gene expression
GO:0051247	0.334	positive regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.989	protein-containing complex
GO:0043226	0.811	organelle
GO:0043231	0.650	intracellular membrane-bounded organelle
GO:0005634	0.631	nucleus
GO:0005851	0.608	eukaryotic translation initiation factor 2B complex
GO:0031981	0.341	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]